MTMR2 (NM_016156) Human Tagged ORF Clone

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name MTMR2 (NM_016156) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MTMR2
Synonyms CMT4B; CMT4B1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC208703 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACGAGCTCGAGCTGCGAGAGTCTTGGCTCCCAGCCGGCGGCGGCTCGGCCGCCCAGCGTGGACT
CCTTGTCCAGTGCCTCCACTTCTCATTCAGAGAATTCAGTGCATACAAAATCAGCTTCTGTTGTATCATC
AGATTCCATTTCAACTTCTGCCGACAACTTTTCTCCTGATTTGAGGGTCCTGAGGGAGTCTAACAAGTTA
GCAGAAATGGAAGAACCACCCTTGCTTCCAGGAGAAAATATTAAAGACATGGCCAAAGATGTAACTTATA
TATGTCCATTCACTGGCGCTGTACGAGGAACTCTGACTGTCACGAATTATAGGTTATATTTCAAAAGCAT
GGAACGGGATCCCCCATTTGTTTTAGATGCTTCCCTTGGTGTGATAAATAGAGTAGAAAAAATTGGTGGT
GCTTCTAGTCGAGGTGAAAATTCTTATGGACTAGAAACTGTGTGTAAGGATATTAGGAATTTACGATTTG
CTCATAAACCTGAGGGGCGGACAAGAAGATCCATATTTGAGAATCTAATGAAATATGCATTTCCTGTCTC
TAATAACCTGCCTCTTTTTGCTTTTGAATACAAAGAAGTATTCCCTGAAAATGGGTGGAAGCTATATGAC
CCTCTTTTAGAGTATAGAAGGCAGGGAATTCCAAATGAAAGCTGGAGAATAACAAAGATAAATGAACGAT
ATGAACTTTGTGATACATACCCTGCCCTCCTGGTTGTGCCAGCAAATATTCCTGATGAAGAATTAAAGAG
AGTGGCATCCTTCAGATCAAGAGGCCGTATCCCAGTTTTATCATGGATTCATCCTGAAAGTCAAGCCACA
ATCACTCGGTGTAGCCAGCCCATGGTTGGAGTGAGTGGAAAGCGAAGCAAAGAAGATGAAAAATACCTTC
AAGCTATCATGGATTCCAATGCCCAGTCTCACAAAATCTTTATATTTGATGCCCGGCCAAGTGTTAATGC
TGTTGCCAACAAGGCAAAGGGTGGAGGTTATGAAAGTGAAGATGCCTATCAAAATGCTGAACTAGTTTTC
CTGGATATCCACAATATTCATGTTATGAGAGAATCATTACGAAAACTTAAGGAGATTGTGTACCCCAACA
TTGAGGAAACTCACTGGTTGTCTAACTTGGAATCTACTCATTGGCTAGAACATATTAAGCTTATTCTTGC
AGGGGCTCTTAGGATTGCTGACAAGGTAGAGTCAGGGAAGACGTCTGTGGTAGTGCATTGCAGTGATGGT
TGGGATCGCACAGCTCAGCTCACTTCCCTTGCCATGCTCATGTTGGATGGATACTATCGAACCATCCGAG
GATTTGAAGTCCTTGTGGAGAAAGAATGGCTAAGTTTTGGACATCGATTTCAACTAAGAGTTGGCCATGG
AGATAAGAACCATGCAGATGCAGACAGATCGCCTGTTTTTCTTCAATTTATTGACTGTGTCTGGCAGATG
ACAAGACAGTTTCCTACCGCATTTGAATTCAATGAGTATTTTCTCATTACCATTTTGGACCACCTATACA
GCTGCTTATTCGGAACATTCCTCTGTAATAGTGAACAACAGAGAGGAAAAGAGAATCTTCCTAAAAGGAC
TGTGTCACTGTGGTCTTACATAAACAGCCAGCTGGAAGACTTCACTAATCCTCTCTATGGGAGCTATTCC
AATCATGTCCTTTATCCAGTAGCCAGCATGCGCCACCTAGAGCTCTGGGTGGGATATTACATAAGGTGGA
ATCCACGGATGAAACCACAGGAACCTATTCACAACAGATACAAAGAACTTCTTGCTAAACGAGCAGAGCT
TCAGAAAAAAGTAGAGGAACTACAGAGAGAGATTTCTAACCGATCAACCTCATCCTCAGAGAGAGCCAGC
TCTCCTGCACAGTGTGTCACTCCTGTCCAAACTGTTGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208703 protein sequence
Red=Cloning site Green=Tags(s)

METSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKL
AEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGG
ASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGWKLYD
PLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQAT
ITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVF
LDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG
WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQM
TRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYS
NHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERAS
SPAQCVTPVQTVV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016156
ORF Size 1929 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016156.1, NM_016156.2, NM_016156.3, NM_016156.4, NM_016156.5, NP_057240.3
RefSeq Size 4603 bp
RefSeq ORF 1932 bp
Locus ID 8898
Cytogenetics 11q21
Domains PTPc_motif, GRAM
Protein Families Druggable Genome, Phosphatase
Protein Pathways Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism
MW 73.4 kDa
Gene Summary This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Other Versions

Other products for "MTMR2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools