PCGF5 (NM_032373) Human Tagged ORF Clone

CAT#: RC208679

PCGF5 (Myc-DDK-tagged)-Human polycomb group ring finger 5 (PCGF5)

Product Images

Western blot validation of overexpression lysate (Cat# LY410166) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC208679 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PCGF5
• Synonyms: RNF159
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC208679 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTACCCAAAGGAAACACTTGGTGAAAGATTTTAATCCTTACATTACCTGCTATATCTGTAAAGGGT
  ATCTGATCAAGCCAACAACAGTGACGGAATGCCTCCATACATTCTGTAAGACTTGTATTGTTCAGCACTT
  TGAAGATAGCAATGATTGCCCAAGGTGTGGCAACCAAGTTCATGAGACAAATCCATTAGAAATGTTGAGG
  TTGGACAATACATTAGAGGAAATTATATTTAAGCTGGTCCCTGGACTACGAGAACAAGAACTTGAGCGTG
  AATCTGAATTTTGGAAGAAAAATAAGCCTCAAGAAAATGGACAAGATGATACTTCAAAAGCTGACAAACC
  GAAAGTAGATGAAGAAGGTGATGAAAATGAAGATGATAAAGATTATCACAGAAGTGACCCACAAATTGCT
  ATCTGTCTAGATTGTTTACGAAATAATGGGCAATCAGGGGACAATGTAGTAAAGGGTTTAATGAAGAAAT
  TCATTCGATGTTCTACACGTGTAACTGTGGGAACTATTAAAAAATTTCTAAGTTTAAAACTAAAACTTCC
  AAGTTCTTATGAGTTGGATGTGCTGTGCAATGGTGAAATTATGGGGAAGGATCATACTATGGAATTCATC
  TACATGACAAGATGGCGACTAAGAGGCGAAAACTTTCGGTGTCTGAACTGCTCAGCTTCGCAAGTCTGCT
  CTCAGGATGGCCCTTTGTATCAGTCATACCCTATGGTACTGCAGTATCGACCAAGAATTGATTTCGGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC208679 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLR
  LDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIA
  ICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFI
  YMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_032373
• ORF Size: 768 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_032373.5
• RefSeq Size: 7222 bp
• RefSeq ORF: 771 bp
• Locus ID: 84333
• UniProt ID: Q86SE9
• Cytogenetics: 10q23.32
• MW: 29.7 kDa
• Gene Summary: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:26151332). Within the PRC1-like complex, regulates RNF2 ubiquitin ligase activity (PubMed:26151332). Plays a redundant role with PCGF3 as part of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females (By similarity).[UniProtKB/Swiss-Prot Function]