TMPRSS2 (NM_005656) Human Tagged ORF Clone

CAT#: RC208677

Reviews ()
Write a review

TMPRSS2 (Myc-DDK-tagged)-Human transmembrane protease, serine 2 (TMPRSS2), transcript variant 2



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TMPRSS2
Synonyms PRSS10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208677 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAA
ACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTC
CCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAA
TCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCT
TCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGG
GATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCC
GGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTC
AGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGA
CATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAA
AAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATCGT
GGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTG
TGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACA
ATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCA
AGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAG
CTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGC
AGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCT
GAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATC
ACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGC
CTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAA
AGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCA
GACGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208677 protein sequence
Red=Cloning site Green=Tags(s)

MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPK
SPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCP
GGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFM
KLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHV
CGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMK
LQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI
TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRA
DG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005656
ORF Size 1476 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005656.4
RefSeq Size 3212 bp
RefSeq ORF 1479 bp
Locus ID 7113
UniProt ID O15393
Cytogenetics 21q22.3
Domains SR, Tryp_SPc, ldl_recept_a
Protein Families Druggable Genome, Protease, Secreted Protein, Transmembrane
MW 53.9 kDa
Gene Summary This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. This protein also facilitates entry of viruses into host cells by proteolytically cleaving and activating viral envelope glycoproteins. Viruses found to use this protein for cell entry include Influenza virus and the human coronaviruses HCoV-229E, MERS-CoV, SARS-CoV and SARS-CoV-2 (COVID-19 virus). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2020]
Other products for "TMPRSS2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.