Serum Response Factor (SRF) (NM_003131) Human Tagged ORF Clone

CAT#: RC208596

Reviews ()
Write a review

SRF (Myc-DDK-tagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)



Reconstitution Protocol

USD 473.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SRF
Synonyms MCM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208596 representing NM_003131
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTACCGACCCAAGCTGGGGCCGCGGCGGCTCTGGGCCGGGGCTCGGCCCTGGGGGGCAGCCTGAACC
GGACCCCGACGGGGCGGCCGGGCGGCGGCGGCGGGACACGCGGGGCTAACGGGGGCCGGGTCCCCGGGAA
TGGCGCGGGGCTCGGGCCCGGCCGCCTGGAGCGGGAGGCTGCGGCAGCGGCGGCAACCACCCCGGCGCCC
ACCGCGGGGGCCCTCTACAGCGGCAGCGAGGGCGACTCGGAGTCGGGCGAGGAGGAGGAGCTGGGCGCCG
AGCGGCGCGGCCTGAAGCGGAGCCTGAGCGAGATGGAGATCGGTATGGTGGTCGGTGGGCCCGAGGCGTC
GGCAGCGGCCACCGGGGGCTACGGGCCGGTGAGCGGCGCGGTGAGCGGGGCCAAGCCGGGTAAGAAGACC
CGGGGCCGCGTGAAGATCAAGATGGAGTTCATCGACAACAAGCTGCGGCGCTACACGACCTTCAGCAAGA
GGAAGACGGGCATCATGAAGAAGGCCTATGAGCTGTCCACGCTGACAGGGACACAGGTGCTGTTGCTGGT
GGCCAGTGAGACAGGCCATGTGTATACCTTTGCCACCCGAAAACTGCAGCCCATGATCACCAGTGAGACC
GGCAAGGCACTGATTCAGACCTGCCTCAACTCGCCAGACTCTCCACCCCGTTCAGACCCCACAACAGACC
AGAGAATGAGTGCCACTGGCTTTGAAGAGACAGATCTCACCTACCAGGTGTCGGAGTCTGACAGCAGTGG
GGAGACCAAGGACACACTGAAGCCGGCGTTCACAGTCACCAACCTGCCGGGTACAACCTCCACCATCCAA
ACAGCACCTAGCACCTCTACCACCATGCAAGTCAGCAGCGGCCCCTCCTTTCCCATCACCAACTACCTGG
CACCAGTGTCTGCTAGTGTCAGCCCCAGTGCTGTCAGCAGTGCCAATGGGACTGTGCTGAAGAGTACAGG
CAGCGGCCCTGTCTCCTCTGGGGGCCTTATGCAGCTGCCTACCAGCTTCACCCTCATGCCTGGTGGGGCA
GTGGCCCAGCAGGTCCCAGTGCAGGCCATTCAAGTGCACCAGGCCCCACAGCAAGCGTCTCCCTCCCGTG
ACAGCAGCACAGACCTCACGCAGACCTCCTCCAGCGGGACAGTGACGCTGCCCGCCACCATCATGACGTC
ATCCGTGCCCACAACTGTGGGTGGCCACATGATGTACCCTAGCCCGCATGCGGTGATGTATGCCCCCACC
TCGGGCCTGGGTGATGGCAGCCTCACCGTGCTGAATGCCTTCTCCCAGGCACCATCCACCATGCAGGTGT
CACACAGCCAGGTCCAGGAGCCAGGTGGCGTCCCCCAGGTGTTCCTGACAGCATCATCTGGGACAGTGCA
GATCCCTGTTTCAGCAGTTCAGCTCCACCAGATGGCTGTGATAGGGCAGCAGGCCGGGAGCAGCAGCAAC
CTCACCGAGCTACAGGTGGTGAACCTGGACACCGCCCACAGCACCAAGAGTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208596 representing NM_003131
Red=Cloning site Green=Tags(s)

MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAP
TAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKT
RGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSET
GKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQ
TAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGA
VAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSN
LTELQVVNLDTAHSTKSE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003131
ORF Size 1524 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003131.4
RefSeq Size 4343 bp
RefSeq ORF 1527 bp
Locus ID 6722
UniProt ID P11831
Cytogenetics 6p21.1
Domains MADS
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway
MW 51.4 kDa
Gene Summary This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.