TRIM16 (NM_006470) Human Tagged ORF Clone

CAT#: RC208564

Reviews ()
Write a review

TRIM16 (Myc-DDK-tagged)-Human tripartite motif containing 16 (TRIM16)



Reconstitution Protocol

USD 525.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TRIM16"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRIM16
Synonyms EBBP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208564 representing NM_006470
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGTTGGATCTAATGGCTCCAGGGCCACTGCCCAGGGCCACTGCTCAGCCCCCAGCCCCTCTCA
GCCCAGACTCTGGGTCACCCAGCCCAGATTCTGGGTCAGCCAGCCCAGTGGAAGAAGAGGACGTGGGCTC
CTCGGAGAAGCTTGGCAGGGAGACGGAGGAACAGGACAGCGACTCTGCAGAGCAGGGGGATCCTGCTGGT
GAGGGGAAAGAGGTCCTGTGTGACTTCTGCCTTGATGACACCAGAAGAGTGAAGGCAGTGAAGTCCTGTC
TAACCTGCATGGTGAATTACTGTGAAGAGCACTTGCAGCCGCATCAGGTGAACATCAAACTGCAAAGCCA
CCTGCTGACCGAGCCAGTGAAGGACCACAACTGGCGATACTGCCCTGCCCACCACAGCCCACTGTCTGCC
TTCTGCTGCCCTGATCAGCAGTGCATCTGCCAGGACTGTTGCCAGGAGCACAGTGGCCACACCATAGTCT
CCCTGGATGCAGCCCGCAGGGACAAGGAGGCTGAACTCCAGTGCACCCAGTTAGACTTGGAGCGGAAACT
CAAGTTGAATGAAAATGCCATCTCCAGGCTCCAGGCTAACCAAAAGTCTGTTCTGGTGTCGGTGTCAGAG
GTCAAAGCGGTGGCTGAAATGCAGTTTGGGGAACTCCTTGCTGCTGTGAGGAAGGCCCAGGCCAATGTGA
TGCTCTTCTTAGAGGAGAAGGAGCAAGCTGCGCTGAGCCAGGCCAACGGTATCAAGGCCCACCTGGAGTA
CAGGAGTGCCGAGATGGAGAAGAGCAAGCAGGAGCTGGAGAGGATGGCGGCCATCAGCAACACTGTCCAG
TTCTTGGAGGAGTACTGCAAGTTTAAGAACACTGAAGACATCACCTTCCCTAGTGTTTACGTAGGGCTGA
AGGATAAACTCTCGGGCATCCGCAAAGTTATCACGGAATCCACTGTACACTTAATCCAGTTGCTGGAGAA
CTATAAGAAAAAGCTCCAGGAGTTTTCCAAGGAAGAGGAGTATGACATCAGAACTCAAGTGTCTGCCGTT
GTTCAGCGCAAATATTGGACTTCCAAACCTGAGCCCAGCACCAGGGAACAGTTCCTCCAATATGCGTATG
ACATCACGTTTGACCCGGACACAGCACACAAGTATCTCCGGCTGCAGGAGGAGAACCGCAAGGTCACCAA
CACCACGCCCTGGGAGCATCCCTACCCGGACCTCCCCAGCAGGTTCCTGCACTGGCGGCAGGTGCTGTCC
CAGCAGAGTCTGTACCTGCACAGGTACTATTTTGAGGTGGAGATCTTCGGGGCAGGCACCTATGTTGGCC
TGACCTGCAAAGGCATCGACCGGAAAGGGGAGGAGCGCAACAGTTGCATTTCCGGAAACAACTTCTCCTG
GAGCCTCCAATGGAACGGGAAGGAGTTCACGGCCTGGTACAGTGACATGGAGACCCCACTCAAAGCTGGC
CCTTTCCGGAGGCTCGGGGTCTATATCGACTTCCCGGGAGGGATCCTTTCCTTCTATGGCGTAGAGTATG
ATACCATGACTCTGGTTCACAAGTTTGCCTGCAAATTTTCAGAACCAGTCTATGCTGCCTTCTGGCTTTC
CAAGAAGGAAAACGCCATCCGGATTGTAGATCTGGGAGAGGAACCCGAGAAGCCAGCACCGTCCTTGGTG
GGGACTGCTCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208564 representing NM_006470
Red=Cloning site Green=Tags(s)

MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAG
EGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSA
FCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSE
VKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMAAISNTVQ
FLEEYCKFKNTEDITFPSVYVGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAV
VQRKYWTSKPEPSTREQFLQYAYDITFDPDTAHKYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLS
QQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAG
PFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLV
GTAP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006470
ORF Size 1692 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006470.4
RefSeq Size 2920 bp
RefSeq ORF 1695 bp
Locus ID 10626
UniProt ID O95361
Cytogenetics 17p12
Domains zf-B_box, SPRY, PRY
Protein Families Druggable Genome, Transcription Factors
MW 63.8 kDa
Gene Summary The protein encoded by this gene is a tripartite motif (TRIM) family member that contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. While it lacks a RING domain found in other TRIM proteins, the encoded protein can homodimerize or heterodimerize with other TRIM proteins and has E3 ubiquitin ligase activity. This gene is also a tumor suppressor and is involved in secretory autophagy. [provided by RefSeq, Jan 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.