CD163 (NM_004244) Human Tagged ORF Clone

CAT#: RC208557

Reviews ()
Write a review

CD163 (Myc-DDK-tagged)-Human CD163 molecule (CD163), transcript variant 1



  "NM_004244" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,006.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CD163"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CD163
Synonyms M130; MM130; SCARI1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208557 representing NM_004244.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAGCAAACTCAGAATGGTGCTACTTGAAGACTCTGGATCTGCTGACTTCAGAAGACATTTTGTCAAC
TTGAGTCCCTTCACCATTACTGTGGTCTTACTTCTCAGTGCCTGTTTTGTCACCAGTTCTCTTGGAGGA
ACAGACAAGGAGCTGAGGCTAGTGGATGGTGAAAACAAGTGTAGCGGGAGAGTGGAAGTGAAAGTCCAG
GAGGAGTGGGGAACGGTGTGTAATAATGGCTGGAGCATGGAAGCGGTCTCTGTGATTTGTAACCAGCTG
GGATGTCCAACTGCTATCAAAGCCCCTGGATGGGCTAATTCCAGTGCAGGTTCTGGACGCATTTGGATG
GATCATGTTTCTTGTCGTGGGAATGAGTCAGCTCTTTGGGATTGCAAACATGATGGATGGGGAAAGCAT
AGTAACTGTACTCACCAACAAGATGCTGGAGTGACCTGCTCAGATGGATCCAATTTGGAAATGAGGCTG
ACGCGTGGAGGGAATATGTGTTCTGGAAGAATAGAGATCAAATTCCAAGGACGGTGGGGAACAGTGTGT
GATGATAACTTCAACATAGATCATGCATCTGTCATTTGTAGACAACTTGAATGTGGAAGTGCTGTCAGT
TTCTCTGGTTCATCTAATTTTGGAGAAGGCTCTGGACCAATCTGGTTTGATGATCTTATATGCAACGGA
AATGAGTCAGCTCTCTGGAACTGCAAACATCAAGGATGGGGAAAGCATAACTGTGATCATGCTGAGGAT
GCTGGAGTGATTTGCTCAAAGGGAGCAGATCTGAGCCTGAGACTGGTAGATGGAGTCACTGAATGTTCA
GGAAGATTAGAAGTGAGATTCCAAGGAGAATGGGGGACAATATGTGATGACGGCTGGGACAGTTACGAT
GCTGCTGTGGCATGCAAGCAACTGGGATGTCCAACTGCCGTCACAGCCATTGGTCGAGTTAACGCCAGT
AAGGGATTTGGACACATCTGGCTTGACAGCGTTTCTTGCCAGGGACATGAACCTGCTGTCTGGCAATGT
AAACACCATGAATGGGGAAAGCATTATTGCAATCACAATGAAGATGCTGGCGTGACATGTTCTGATGGA
TCAGATCTGGAGCTAAGACTTAGAGGTGGAGGCAGCCGCTGTGCTGGGACAGTTGAGGTGGAGATTCAG
AGACTGTTAGGGAAGGTGTGTGACAGAGGCTGGGGACTGAAAGAAGCTGATGTGGTTTGCAGGCAGCTG
GGATGTGGATCTGCACTCAAAACATCTTATCAAGTGTACTCCAAAATCCAGGCAACAAACACATGGCTG
TTTCTAAGTAGCTGTAACGGAAATGAAACTTCTCTTTGGGACTGCAAGAACTGGCAATGGGGTGGACTT
ACCTGTGATCACTATGAAGAAGCCAAAATTACCTGCTCAGCCCACAGGGAACCCAGACTGGTTGGAGGG
GACATTCCCTGTTCTGGACGTGTTGAAGTGAAGCATGGTGACACGTGGGGCTCCATCTGTGATTCGGAC
TTCTCTCTGGAAGCTGCCAGCGTTCTATGCAGGGAATTACAGTGTGGCACAGTTGTCTCTATCCTGGGG
GGAGCTCACTTTGGAGAGGGAAATGGACAGATCTGGGCTGAAGAATTCCAGTGTGAGGGACATGAGTCC
CATCTTTCACTCTGCCCAGTAGCACCCCGCCCAGAAGGAACTTGTAGCCACAGCAGGGATGTTGGAGTA
GTCTGCTCAAGATACACAGAAATTCGCTTGGTGAATGGCAAGACCCCGTGTGAGGGCAGAGTGGAGCTC
AAAACGCTTGGTGCCTGGGGATCCCTCTGTAACTCTCACTGGGACATAGAAGATGCCCATGTTCTTTGC
CAGCAGCTTAAATGTGGAGTTGCCCTTTCTACCCCAGGAGGAGCACGTTTTGGAAAAGGAAATGGTCAG
ATCTGGAGGCATATGTTTCACTGCACTGGGACTGAGCAGCACATGGGAGATTGTCCTGTAACTGCTCTA
GGTGCTTCATTATGTCCTTCAGAGCAAGTGGCCTCTGTAATCTGCTCAGGAAACCAGTCCCAAACACTG
TCCTCGTGCAATTCATCGTCTTTGGGCCCAACAAGGCCTACCATTCCAGAAGAAAGTGCTGTGGCCTGC
ATAGAGAGTGGTCAACTTCGCCTGGTAAATGGAGGAGGTCGCTGTGCTGGGAGAGTAGAGATCTATCAT
GAGGGCTCCTGGGGCACCATCTGTGATGACAGCTGGGACCTGAGTGATGCCCACGTGGTTTGCAGACAG
CTGGGCTGTGGAGAGGCCATTAATGCCACTGGTTCTGCTCATTTTGGGGAAGGAACAGGGCCCATCTGG
CTGGATGAGATGAAATGCAATGGAAAAGAATCCCGCATTTGGCAGTGCCATTCACACGGCTGGGGGCAG
CAAAATTGCAGGCACAAGGAGGATGCGGGAGTTATCTGCTCAGAATTCATGTCTCTGAGACTGACCAGT
GAAGCCAGCAGAGAGGCCTGTGCAGGGCGTCTGGAAGTTTTTTACAATGGAGCTTGGGGCACTGTTGGC
AAGAGTAGCATGTCTGAAACCACTGTGGGTGTGGTGTGCAGGCAGCTGGGCTGTGCAGACAAAGGGAAA
ATCAACCCTGCATCTTTAGACAAGGCCATGTCCATTCCCATGTGGGTGGACAATGTTCAGTGTCCAAAA
GGACCTGACACGCTGTGGCAGTGCCCATCATCTCCATGGGAGAAGAGACTGGCCAGCCCCTCGGAGGAG
ACCTGGATCACATGTGACAACAAGATAAGACTTCAGGAAGGACCCACTTCCTGTTCTGGACGTGTGGAG
ATCTGGCATGGAGGTTCCTGGGGGACAGTGTGTGATGACTCTTGGGACTTGGACGATGCTCAGGTGGTG
TGTCAACAACTTGGCTGTGGTCCAGCTTTGAAAGCATTCAAAGAAGCAGAGTTTGGTCAGGGGACTGGA
CCGATATGGCTCAATGAAGTGAAGTGCAAAGGGAATGAGTCTTCCTTGTGGGATTGTCCTGCCAGACGC
TGGGGCCATAGTGAGTGTGGGCACAAGGAAGACGCTGCAGTGAATTGCACAGATATTTCAGTGCAGAAA
ACCCCACAAAAAGCCACAACAGGTCGCTCATCCCGTCAGTCATCCTTTATTGCAGTCGGGATCCTTGGG
GTTGTTCTGTTGGCCATTTTCGTCGCATTATTCTTCTTGACTAAAAAGCGAAGACAGAGACAGCGGCTT
GCAGTTTCCTCAAGAGGAGAGAACTTAGTCCACCAAATTCAATACCGGGAGATGAATTCTTGCCTGAAT
GCAGATGATCTGGACCTAATGAATTCCTCAGAAAATTCCCATGAGTCAGCTGATTTCAGTGCTGCTGAA
CTAATTTCTGTGTCTAAATTTCTTCCTATTTCTGGAATGGAAAAGGAGGCCATTCTGAGCCACACTGAA
AAGGAAAATGGGAATTTA

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
>Peptide sequence encoded by RC208557
Blue=ORF Red=Cloning site Green=Tag(s)

MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKCSGRVEVKVQ
EEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKH
SNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVS
FSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECS
GRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQC
KHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQL
GCGSALKTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRLVGG
DIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHES
HLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKTLGAWGSLCNSHWDIEDAHVLC
QQLKCGVALSTPGGARFGKGNGQIWRHMFHCTGTEQHMGDCPVTALGASLCPSEQVASVICSGNQSQTL
SSCNSSSLGPTRPTIPEESAVACIESGQLRLVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQ
LGCGEAINATGSAHFGEGTGPIWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTS
EASREACAGRLEVFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPK
GPDTLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLDDAQVV
CQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGHKEDAAVNCTDISVQK
TPQKATTGRSSRQSSFIAVGILGVVLLAIFVALFFLTKKRRQRQRLAVSSRGENLVHQIQYREMNSCLN
ADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC208557 also available, TP308557
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004244
ORF Size 3468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004244.4
RefSeq Size 4190 bp
RefSeq ORF 3471 bp
Locus ID 9332
UniProt ID Q86VB7
Cytogenetics 12p13.31
Domains SR
Protein Families Druggable Genome, Secreted Protein, Transmembrane
MW 125.4 kDa
Gene Summary The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages, and may thereby protect tissues from free hemoglobin-mediated oxidative damage. This protein may also function as an innate immune sensor for bacteria and inducer of local inflammation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.