TAB1 (NM_006116) Human Tagged ORF Clone

CAT#: RC208522

TAB1 (Myc-DDK-tagged)-Human TGF-beta activated kinase 1/MAP3K7 binding protein 1 (TAB1), transcript variant alpha

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TAB1 (NM_006116) Human Tagged ORF Clone
Symbol TAB1
Synonyms 3 -Tab1; MAP3K7IP1; 3'-Tab1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208522 representing NM_006116
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGCAGAGGAGGAGCTTGCTGCAGAGTGAGCAGCAGCCAAGCTGGACAGATGACCTGCCTCTCT
GCCACCTCTCTGGGGTTGGCTCAGCCTCCAACCGCAGCTACTCTGCTGATGGCAAGGGCACTGAGAGCCA
CCCGCCAGAGGACAGCTGGCTCAAGTTCAGGAGTGAGAACAACTGCTTCCTGTATGGGGTCTTCAACGGC
TATGATGGCAACCGAGTGACCAACTTCGTGGCCCAGCGGCTGTCCGCAGAGCTCCTGCTGGGCCAGCTGA
ATGCCGAGCACGCCGAGGCCGATGTGCGGCGTGTGCTGCTGCAGGCCTTCGATGTGGTGGAGAGGAGCTT
CCTGGAGTCCATTGACGACGCCTTGGCTGAGAAGGCAAGCCTCCAGTCGCAATTGCCAGAGGGAGTCCCT
CAGCACCAGCTGCCTCCTCAGTATCAGAAGATCCTTGAGAGACTCAAGACGTTAGAGAGGGAAATTTCGG
GAGGGGCCATGGCCGTTGTGGCGGTCCTTCTCAACAACAAGCTCTACGTCGCCAATGTCGGTACAAACCG
TGCACTTTTATGCAAATCGACAGTGGATGGGTTGCAGGTGACACAGCTGAACGTGGACCACACCACAGAG
AACGAGGATGAGCTCTTCCGTCTTTCGCAGCTGGGCTTGGATGCTGGAAAGATCAAGCAGGTGGGGATCA
TCTGTGGGCAGGAGAGCACCCGGCGGATCGGGGATTACAAGGTTAAATATGGCTACACGGACATTGACCT
TCTCAGCGCTGCCAAGTCCAAACCAATCATCGCAGAGCCAGAAATCCATGGGGCACAGCCGCTGGATGGG
GTGACGGGCTTCTTGGTGCTGATGTCGGAGGGGTTGTACAAGGCCCTAGAGGCAGCCCATGGGCCTGGGC
AGGCCAACCAGGAGATTGCTGCGATGATTGACACTGAGTTTGCCAAGCAGACCTCCCTGGACGCAGTGGC
CCAGGCCGTCGTGGACCGGGTGAAGCGCATCCACAGCGACACCTTCGCCAGTGGTGGGGAGCGTGCCAGG
TTCTGCCCCCGGCACGAGGACATGACCCTGCTAGTGAGGAACTTTGGCTACCCGCTGGGCGAAATGAGCC
AGCCCACACCGAGCCCAGCCCCAGCTGCAGGAGGACGAGTGTACCCTGTGTCTGTGCCATACTCCAGCGC
CCAGAGCACCAGCAAGACCAGCGTGACCCTCTCCCTTGTCATGCCCTCCCAGGGCCAGATGGTCAACGGG
GCTCACAGTGCTTCCACCCTGGACGAAGCCACCCCCACCCTCACCAACCAAAGCCCGACCTTAACCCTGC
AGTCCACCAACACGCACACGCAGAGCAGCAGCTCCAGCTCTGACGGAGGCCTCTTCCGCTCCCGGCCCGC
CCACTCGCTCCCGCCTGGCGAGGACGGTCGTGTTGAGCCCTATGTGGACTTTGCTGAGTTTTACCGCCTC
TGGAGCGTGGACCATGGCGAGCAGAGCGTGGTGACAGCACCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208522 representing NM_006116
Red=Cloning site Green=Tags(s)

MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNG
YDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVP
QHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTE
NEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDG
VTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAR
FCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRL
WSVDHGEQSVVTAP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006116
ORF Size 1512 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006116.1, NM_006116.2, NP_006107
RefSeq Size 3240
Locus ID 10454
Cytogenetics 22q13.1
Domains PP2C
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway
MW 54.5 kDa
Gene Summary The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.