Semaphorin 4D (SEMA4D) (NM_006378) Human Tagged ORF Clone

CAT#: RC208521

Reviews ()
Write a review

SEMA4D (Myc-DDK-tagged)-Human sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D (SEMA4D), transcript variant 1



Reconstitution Protocol

USD 1,184.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SEMA4D"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEMA4D
Synonyms A8; BB18; C9orf164; CD100; coll-4; COLL4; GR3; M-sema-G; SEMAJ
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208521 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGATGTGCACCCCCATTAGGGGGCTGCTCATGGCCCTTGCAGTGATGTTTGGGACAGCGATGGCAT
TTGCACCCATACCCCGGATCACCTGGGAGCACAGAGAGGTGCACCTGGTGCAGTTTCATGAGCCAGACAT
CTACAACTACTCAGCCTTGCTGCTGAGCGAGGACAAGGACACCTTGTACATAGGTGCCCGGGAGGCGGTC
TTCGCTGTGAACGCACTCAACATCTCCGAGAAGCAGCATGAGGTGTATTGGAAGGTCTCAGAAGACAAAA
AAGCAAAATGTGCAGAAAAGGGGAAATCAAAACAGACAGAGTGCCTCAACTACATCCGGGTGCTGCAGCC
ACTCAGCGCCACTTCCCTTTACGTGTGTGGGACCAACGCATTCCAGCCGGCCTGTGACCACCTGAACTTA
ACATCCTTTAAGTTTCTGGGGAAAAATGAAGATGGCAAAGGAAGATGTCCCTTTGACCCAGCACACAGCT
ACACATCCGTCATGGTTGATGGAGAACTTTATTCGGGGACGTCGTATAATTTTTTGGGAAGTGAACCCAT
CATCTCCCGAAATTCTTCCCACAGTCCTCTGAGGACAGAATATGCAATCCCTTGGCTGAACGAGCCTAGT
TTCGTGTTTGCTGACGTGATCCGAAAAAGCCCAGACAGCCCCGACGGCGAGGATGACAGGGTCTACTTCT
TCTTCACGGAGGTGTCTGTGGAGTATGAGTTTGTGTTCAGGGTGCTGATCCCACGGATAGCAAGAGTGTG
CAAGGGGGACCAGGGCGGCCTGAGGACCTTGCAGAAGAAATGGACCTCCTTCCTGAAAGCCCGACTCATC
TGCTCCCGGCCAGACAGCGGCTTGGTCTTCAATGTGCTGCGGGATGTCTTCGTGCTCAGGTCCCCGGGCC
TGAAGGTGCCTGTGTTCTATGCACTCTTCACCCCACAGCTGAACAACGTGGGGCTGTCGGCAGTGTGCGC
CTACAACCTGTCCACAGCCGAGGAGGTCTTCTCCCACGGGAAGTACATGCAGAGCACCACAGTGGAGCAG
TCCCACACCAAGTGGGTGCGCTATAATGGCCCGGTACCCAAGCCGCGGCCTGGAGCGTGCATCGACAGCG
AGGCACGGGCCGCCAACTACACCAGCTCCTTGAATTTGCCAGACAAGACGCTGCAGTTCGTTAAAGACCA
CCCTTTGATGGATGACTCGGTAACCCCAATAGACAACAGGCCCAGGTTAATCAAGAAAGATGTGAACTAC
ACCCAGATCGTGGTGGACCGGACCCAGGCCCTGGATGGGACTGTCTATGATGTCATGTTTGTCAGCACAG
ACCGGGGAGCTCTGCACAAAGCCATCAGCCTCGAGCACGCTGTTCACATCATCGAGGAGACCCAGCTCTT
CCAGGACTTTGAGCCAGTCCAGACCCTGCTGCTGTCTTCAAAGAAGGGCAACAGGTTTGTCTATGCTGGC
TCTAACTCGGGCGTGGTCCAGGCCCCGCTGGCCTTCTGTGGGAAGCACGGCACCTGCGAGGACTGTGTGC
TGGCGCGGGACCCCTACTGCGCCTGGAGCCCGCCCACAGCGACCTGCGTGGCTCTGCACCAGACCGAGAG
CCCCAGCAGGGGTTTGATTCAGGAGATGAGCGGCGATGCTTCTGTGTGCCCGGATAAAAGTAAAGGAAGT
TACCGGCAGCATTTTTTCAAGCACGGTGGCACAGCGGAACTGAAATGCTCCCAAAAATCCAACCTGGCCC
GGGTCTTTTGGAAGTTCCAGAATGACGTGTTGAAGGCCGAGAGCCCCAAGTACGGTCTTATGGGCAGAAA
AAACTTGCTCATCTTCAACTTGTCAGAAGGAGACAGTGGGGTGTACCAGTGCCTGTCAGAGGAGAGGGTT
AAGAACAAAACGGTCTTCCAAGTGGTCGCCAAGCACGTCCTGGAAGTGAAGGTGGTTCCAAAGCCCGTAG
TGGCCCCCACCTTGTCAGTTGTTCAGACAGAAGGTAGTAGGATTGCCACCAAAGTGTTGGTGGCATCCAC
CCAAGGGTCTTCTCCCCCAACCCCAGCCGTGCAGGCCACCTCCTCCGGGGCCATCACCCTTCCTCCCAAG
CCTGCGCCCACCGGCACATCCTGCGAACCAAAGATCGTCATCAACACGGTCCCCCAGCTCCACTCGGAGA
AAACCATGTATCTTAAGTCCAGCGACAACCGCCTCCTCATGTCCCTCTTCCTCTTCTTCTTTGTTCTCTT
CCTCTGCCTCTTTTTCTACAACTGCTATAAGGGATACCTGCCCAGACAGTGCTTGAAATTCCGCTCGGCC
CTACTAATTGGGAAGAAGAAGCCCAAGTCAGATTTCTGTGACCGTGAGCAGAGCCTGAAGGAGACGTTAG
TAGAGCCAGGGAGCTTCTCCCAGCAGAATGGGGAGCACCCCAAGCCAGCCCTGGACACCGGCTATGAGAC
CGAGCAAGACACCATCACCAGCAAAGTCCCCACGGATAGGGAGGACTCACAGAGGATCGACGACCTTTCT
GCCAGGGACAAGCCCTTTGACGTCAAGTGTGAGCTGAAGTTCGCTGACTCAGACGCAGATGGAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208521 protein sequence
Red=Cloning site Green=Tags(s)

MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAV
FAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNL
TSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPS
FVFADVIRKSPDSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLI
CSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQ
SHTKWVRYNGPVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSSKKGNRFVYAG
SNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSRGLIQEMSGDASVCPDKSKGS
YRQHFFKHGGTAELKCSQKSNLARVFWKFQNDVLKAESPKYGLMGRKNLLIFNLSEGDSGVYQCLSEERV
KNKTVFQVVAKHVLEVKVVPKPVVAPTLSVVQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPK
PAPTGTSCEPKIVINTVPQLHSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSA
LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006378
ORF Size 2586 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006378.2, NP_006369.2
RefSeq Size 4642 bp
RefSeq ORF 2589 bp
Locus ID 10507
UniProt ID Q92854
Cytogenetics 9q22.2
Domains Sema, PSI, ig, IG, PSI
Protein Families Druggable Genome, Transmembrane
Protein Pathways Axon guidance
MW 96.2 kDa
Gene Summary Cell surface receptor for PLXNB1 and PLXNB2 that plays an important role in cell-cell signaling (PubMed:20877282). Regulates GABAergic synapse development (By similarity). Promotes the development of inhibitory synapses in a PLXNB1-dependent manner (By similarity). Modulates the complexity and arborization of developing neurites in hippocampal neurons by activating PLXNB1 and interaction with PLXNB1 mediates activation of RHOA (PubMed:19788569). Promotes the migration of cerebellar granule cells (PubMed:16055703). Plays a role in the immune system; induces B-cells to aggregate and improves their viability (in vitro) (PubMed:8876214). Induces endothelial cell migration through the activation of PTK2B/PYK2, SRC, and the phosphatidylinositol 3-kinase-AKT pathway (PubMed:16055703).[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.