Arp3 (ACTR3) (NM_005721) Human Tagged ORF Clone

CAT#: RC208460

Reviews ()
Write a review

ACTR3 (Myc-DDK-tagged)-Human ARP3 actin-related protein 3 homolog (yeast) (ACTR3)



  "NM_005721" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Arp3 (ACTR3) (NM_005721) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACTR3
Synonyms ARP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC208460 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGACGGCTGCCGGCCTGTGTGGTGGACTGTGGCACGGGGTATACAAAACTAGGATATGCTGGAA
ATACAGAACCACAGTTTATCATCCCTTCCTGTATTGCTATTAAGGAGTCAGCAAAAGTGGGTGATCAAGC
TCAAAGGAGGGTGATGAAAGGTGTTGATGACCTAGACTTCTTCATTGGTGATGAAGCAATAGAAAAACCT
ACATATGCAACAAAGTGGCCAATCCGCCATGGTATAGTTGAAGATTGGGACTTAATGGAAAGGTTTATGG
AGCAAGTGATCTTTAAATATTTAAGGGCAGAACCTGAAGACCATTATTTTCTTTTGACTGAACCTCCATT
GAATACTCCAGAAAACAGGGAATATACTGCTGAAATAATGTTTGAGTCCTTCAATGTTCCAGGCTTGTAC
ATTGCTGTGCAGGCTGTTCTTGCCTTAGCTGCATCTTGGACCTCAAGACAAGTAGGAGAACGGACGTTGA
CCGGTACGGTAATAGACAGTGGAGATGGTGTCACTCATGTCATTCCTGTGGCTGAAGGGTATGTGATTGG
CAGCTGTATTAAACACATTCCAATCGCAGGACGAGATATAACATATTTTATTCAGCAACTGCTGAGAGAC
CGAGAAGTAGGAATCCCTCCAGAACAATCCTTGGAAACTGCTAAGGCAGTAAAGGAGCGCTATAGTTATG
TCTGCCCAGATTTAGTAAAAGAATTTAACAAGTATGATACAGATGGGTCAAAATGGATTAAACAGTATAC
TGGAATCAATGCTATCTCAAAGAAAGAGTTTTCTATCGATGTTGGTTATGAGAGATTTTTGGGACCTGAA
ATCTTTTTTCATCCAGAGTTTGCTAATCCAGACTTTACACAACCTATCTCAGAAGTTGTAGATGAAGTAA
TTCAGAATTGTCCTATTGATGTCAGACGTCCTCTCTACAAGAATATTGTCCTCTCTGGAGGTTCAACCAT
GTTCAGGGACTTTGGACGTCGCTTGCAAAGAGATTTGAAAAGAACTGTAGATGCCCGGCTGAAATTAAGT
GAGGAATTGAGTGGTGGTAGATTGAAGCCAAAACCTATTGATGTACAAGTCATTACACACCACATGCAGC
GATATGCAGTTTGGTTTGGAGGATCAATGCTGGCTTCCACGCCTGAGTTCTACCAAGTATGCCACACCAA
AAAGGATTATGAAGAAATTGGACCTAGCATTTGTCGTCACAATCCAGTGTTTGGAGTCATGTCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208460 protein sequence
Red=Cloning site Green=Tags(s)

MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKP
TYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLY
IAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRD
REVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPE
IFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLS
EELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005721
ORF Size 1254 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005721.1, NM_005721.2, NM_005721.3, NM_005721.4, NP_005712.1
RefSeq Size 5708 bp
RefSeq ORF 1257 bp
Locus ID 10096
Cytogenetics 2q14.1
Domains ACTIN
Protein Families Druggable Genome
MW 47.4 kDa
Gene Summary The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Mar 2013]

Citations (1)

Other Versions

Other products for "ACTR3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ACTR3 mouse monoclonal antibody,clone OTI5G4
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools