DHFRL1(DHFRL1) (NM_176815) Human Tagged ORF Clone

CAT#: RC208452

DHFRL1 (Myc-DDK-tagged)-Human dihydrofolate reductase-like 1 (DHFRL1), transcript variant 2

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DHFRL1(DHFRL1) (NM_176815) Human Tagged ORF Clone
Symbol DHFRL1
Synonyms DHFRP4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208452 representing NM_176815
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTCTTTTGCTAAACTGCATCGTCGCTGTGTCCCAAAACATGGGCATCGGCAAGAACGGGGACCTGC
CCAGGCCGCCGCTCAGGAATGAATTCAGGTATTTCCAGAGAATGACCACAACTTCTTCAGTAGAGGGTAA
ACAGAATCTGGTGATTATGGGTAGGAAGACCTGGTTCTCCATTCCTGAGAAGAATCGACCTTTAAAGGAT
AGAATTAATTTAGTTCTCAGCAGAGAACTAAAGGAACCTCCACAAGGAGCTCATTTTCTTGCCAGAAGTT
TGGATGATGCCTTAAAACTTACTGAACGACCAGAATTAGCAAATAAAGTAGACATGATTTGGATAGTTGG
TGGCAGTTCTGTTTATAAGGAAGCCATGAATCACCTAGGCCATCTTAAACTATTTGTGACAAGGATCATG
CAGGACTTTGAAAGTGACACGTTTTTTTCAGAAATTGACTTGGAGAAATATAAACTTCTGCCTGAATACC
CAGGTGTTCTCTCTGATGTCCAGGAGGGGAAACACATCAAGTACAAATTTGAAGTATGTGAGAAGGATGA
T


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208452 representing NM_176815
Red=Cloning site Green=Tags(s)

MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD
RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM
QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_176815
ORF Size 561 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_176815.1, NM_176815.2, NM_176815.3, NM_176815.4, NP_789785
RefSeq Size 3772
RefSeq ORF 564
Locus ID 200895
Cytogenetics 3q11.2
Protein Families Druggable Genome
MW 21.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations