CBX7 (NM_175709) Human Tagged ORF Clone

CAT#: RC208424

CBX7 (Myc-DDK-tagged)-Human chromobox homolog 7 (CBX7)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CBX7 (NM_175709) Human Tagged ORF Clone
Symbol CBX7
Synonyms OTTHUMP00000028984; chromobox homolog 7
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208424 representing NM_175709
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGTCAGCCATCGGCGAGCAGGTGTTCGCCGTGGAGAGCATCCGGAAGAAGCGCGTGCGGAAGG
GTAAAGTCGAGTATCTGGTGAAGTGGAAAGGATGGCCCCCAAAGTACAGCACGTGGGAGCCAGAAGAGCA
CATCTTGGACCCCCGCCTCGTCATGGCCTACGAGGAGAAGGAGGAGAGAGACCGAGCATCGGGGTATAGG
AAGAGAGGTCCGAAACCCAGGCGGCTTCTGCTGCAGCGGCTGTACAGCATGGACCTGCGGAGCTCCCACA
AGGCCAAGGGCAAGGAGAAGCTCTGCTTCTCCCTGACGTGCCCACTCGGCAGCGGGAGCCCTGAGGGGGT
GGTCAAGGCGGGGGCACCTGAGCTGGTGGACAAGGGCCCCTTGGTGCCCACCCTGCCCTTCCCGCTCCGC
AAGCCCCGAAAGGCCCACAAGTACCTGCGGCTCTCGCGCAAGAAGTTCCCGCCCCGCGGGCCCAACCTGG
AGAGCCACAGCCATCGACGGGAGCTCTTCCTGCAGGAGCCACCGGCCCCAGACGTCCTGCAGGCGGCTGG
CGAGTGGGAGCCTGCTGCGCAGCCCCCTGAAGAGGAGGCAGATGCCGACCTGGCCGAGGGGCCCCCTCCC
TGGACACCTGCGCTCCCCTCAAGTGAGGTGACCGTGACCGACATCACCGCCAACTCCATCACCGTCACCT
TCCGCGAGGCCCAGCCAGCTGAGGGCTTCTTCCGAGACCGCAGTGGGAAGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208424 representing NM_175709
Red=Cloning site Green=Tags(s)

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYR
KRGPKPRRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLR
KPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPP
WTPALPSSEVTVTDITANSITVTFREAQPAEGFFRDRSGKF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_175709
ORF Size 753 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_175709.1, NM_175709.2, NM_175709.3, NM_175709.4, NP_783640
RefSeq Size 3966
RefSeq ORF 756
Locus ID 23492
Cytogenetics 22q13.1
MW 28.2 kDa
Gene Summary This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided by RefSeq, Oct 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations