SREBP1 (SREBF1) (NM_004176) Human Tagged ORF Clone

CAT#: RC208404

Reviews ()
Write a review

SREBF1 (Myc-DDK-tagged)-Human sterol regulatory element binding transcription factor 1 (SREBF1), transcript variant 2



  "NM_004176" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 1,360.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SREBF1
Synonyms bHLHd1; HMD; IFAP2; SREBP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208404 representing NM_004176
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCGGCGC
GCC
C

ATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTGCGATCTGGACGCGG
CGCTGCTGACCGACATCGAAGACATGCTTCAGCTTATCAACAACCAAGACAGTGACTTCCCTGGCCTATT
TGACCCACCCTATGCTGGGAGTGGGGCAGGGGGCACAGACCCTGCCAGCCCCGATACCAGCTCCCCAGGC
AGCTTGTCTCCACCTCCTGCCACATTGAGCTCCTCTCTTGAAGCCTTCCTGAGCGGGCCGCAGGCAGCGC
CCTCACCCCTGTCCCCTCCCCAGCCTGCACCCACTCCATTGAAGATGTACCCGTCCATGCCCGCTTTCTC
CCCTGGGCCTGGTATCAAGGAAGAGTCAGTGCCACTGAGCATCCTGCAGACCCCCACCCCACAGCCCCTG
CCAGGGGCCCTCCTGCCACAGAGCTTCCCAGCCCCAGCCCCACCGCAGTTCAGCTCCACCCCTGTGTTAG
GCTACCCCAGCCCTCCGGGAGGCTTCTCTACAGGAAGCCCTCCCGGGAACACCCAGCAGCCGCTGCCTGG
CCTGCCACTGGCTTCCCCGCCAGGGGTCCCGCCCGTCTCCTTGCACACCCAGGTCCAGAGTGTGGTCCCC
CAGCAGCTACTGACAGTCACAGCTGCCCCCACGGCAGCCCCTGTAACGACCACTGTGACCTCGCAGATCC
AGCAGGTCCCGGTCCTGCTGCAGCCCCACTTCATCAAGGCAGACTCGCTGCTTCTGACAGCCATGAAGAC
AGACGGAGCCACTGTGAAGGCGGCAGGTCTCAGTCCCCTGGTCTCTGGCACCACTGTGCAGACAGGGCCT
TTGCCGACCCTGGTGAGTGGCGGAACCATCTTGGCAACAGTCCCACTGGTCGTAGATGCGGAGAAGCTGC
CTATCAACCGGCTCGCAGCTGGCAGCAAGGCCCCGGCCTCTGCCCAGAGCCGTGGAGAGAAGCGCACAGC
CCACAACGCCATTGAGAAGCGCTACCGCTCCTCCATCAATGACAAAATCATTGAGCTCAAGGATCTGGTG
GTGGGCACTGAGGCAAAGCTGAATAAATCTGCTGTCTTGCGCAAGGCCATCGACTACATTCGCTTTCTGC
AACACAGCAACCAGAAACTCAAGCAGGAGAACCTAAGTCTGCGCACTGCTGTCCACAAAAGCAAATCTCT
GAAGGATCTGGTGTCGGCCTGTGGCAGTGGAGGGAACACAGACGTGCTCATGGAGGGCGTGAAGACTGAG
GTGGAGGACACACTGACCCCACCCCCCTCGGATGCTGGCTCACCTTTCCAGAGCAGCCCCTTGTCCCTTG
GCAGAAGGGGCAGTGGCAGCGGTGGCAGTGGCAGTGACTCGGAGCCTGACAGCCCAGTCTTTGAGGACAG
CAAGGCAAAGCCAGAGCAGCGGCCGTCTCTGCACAGCCGGGGCATGCTGGACCGCTCCCGCCTGGCCCTG
TGCACGCTCGTCTTCCTCTGCCTGTCCTGCAACCCCTTGGCCTCCTTGCTGGGGGCCCGGGGGCTTCCCA
GCCCCTCAGATACCACCAGCGTCTACCATAGCCCTGGGCGCAACGTGCTGGGCACCGAGAGCAGAGATGG
CCCTGGCTGGGCCCAGTGGCTGCTGCCCCCAGTGGTCTGGCTGCTCAATGGGCTGTTGGTGCTCGTCTCC
TTGGTGCTTCTCTTTGTCTACGGTGAGCCAGTCACACGGCCCCACTCAGGCCCCGCCGTGTACTTCTGGA
GGCATCGCAAGCAGGCTGACCTGGACCTGGCCCGGGGAGACTTTGCCCAGGCTGCCCAGCAGCTGTGGCT
GGCCCTGCGGGCACTGGGCCGGCCCCTGCCCACCTCCCACCTGGACCTGGCTTGTAGCCTCCTCTGGAAC
CTCATTCGTCACCTGCTGCAGCGTCTCTGGGTGGGCCGCTGGCTGGCAGGCCGGGCAGGGGGCCTGCAGC
AGGACTGTGCTCTGCGAGTGGATGCTAGCGCCAGCGCCCGAGACGCAGCCCTGGTCTACCATAAGCTGCA
CCAGCTGCACACCATGGGGAAGCACACAGGCGGGCACCTCACTGCCACCAACCTGGCGCTGAGTGCCCTG
AACCTGGCAGAGTGTGCAGGGGATGCCGTGTCTGTGGCGACGCTGGCCGAGATCTATGTGGCGGCTGCAT
TGAGAGTGAAGACCAGTCTCCCACGGGCCTTGCATTTTCTGACACGCTTCTTCCTGAGCAGTGCCCGCCA
GGCCTGCCTGGCACAGAGTGGCTCAGTGCCTCCTGCCATGCAGTGGCTCTGCCACCCCGTGGGCCACCGT
TTCTTCGTGGATGGGGACTGGTCCGTGCTCAGTACCCCATGGGAGAGCCTGTACAGCTTGGCCGGGAACC
CAGTGGACCCCCTGGCCCAGGTGACTCAGCTATTCCGGGAACATCTCTTAGAGCGAGCACTGAACTGTGT
GACCCAGCCCAACCCCAGCCCTGGGTCAGCTGATGGGGACAAGGAATTCTCGGATGCCCTCGGGTACCTG
CAGCTGCTGAACAGCTGTTCTGATGCTGCGGGGGCTCCTGCCTACAGCTTCTCCATCAGTTCCAGCATGG
CCACCACCACCGGCGTAGACCCGGTGGCCAAGTGGTGGGCCTCTCTGACAGCTGTGGTGATCCACTGGCT
GCGGCGGGATGAGGAGGCGGCTGAGCGGCTGTGCCCGCTGGTGGAGCACCTGCCCCGGGTGCTGCAGGAG
TCTGAGAGACCCCTGCCCAGGGCAGCTCTGCACTCCTTCAAGGCTGCCCGGGCCCTGCTGGGCTGTGCCA
AGGCAGAGTCTGGTCCAGCCAGCCTGACCATCTGTGAGAAGGCCAGTGGGTACCTGCAGGACAGCCTGGC
TACCACACCAGCCAGCAGCTCCATTGACAAGGCCGTGCAGCTGTTCCTGTGTGACCTGCTTCTTGTGGTG
CGCACCAGCCTGTGGCGGCAGCAGCAGCCCCCGGCCCCGGCCCCAGCAGCCCAGGGCACCAGCAGCAGGC
CCCAGGCTTCCGCCCTTGAGCTGCGTGGCTTCCAACGGGACCTGAGCAGCCTGAGGCGGCTGGCACAGAG
CTTCCGGCCCGCCATGCGGAGGGTGTTCCTACATGAGGCCACGGCCCGGCTGATGGCGGGGGCCAGCCCC
ACACGGACACACCAGCTCCTCGACCGCAGTCTGAGGCGGCGGGCAGGCCCCGGTGGCAAAGGAGGCGCGG
TGGCGGAGCTGGAGCCGCGGCCCACGCGGCGGGAGCACGCGGAGGCCTTGCTGCTGGCCTCCTGCTACCT
GCCCCCCGGCTTCCTGTCGGCGCCCGGGCAGCGCGTGGGCATGCTGGCTGAGGCGGCGCGCACACTCGAG
AAGCTTGGCGATCGCCGGCTGCTGCACGACTGTCAGCAGATGCTCATGCGCCTGGGCGGTGGGACCACTG
TCACTTCCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208404 representing NM_004176
Red=Cloning site Green=Tags(s)

MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPG
SLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPL
PGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVP
QQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGP
LPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLV
VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE
VEDTLTPPPSDAGSPFQSSPLSLGRRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
CTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVS
LVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWN
LIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSAL
NLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHR
FFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQE
SERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVV
RTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP
TRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLE
KLGDRRLLHDCQQMLMRLGGGTTVTSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites AscI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004176
ORF Size 3441 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004176.4
RefSeq Size 4922 bp
RefSeq ORF 3444 bp
Locus ID 6720
UniProt ID P36956
Cytogenetics 17p11.2
Domains HLH
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Insulin signaling pathway
MW 122.2 kDa
Gene Summary This gene encodes a basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a motif that is found in the promoter of the low density lipoprotein receptor gene and other genes involved in sterol biosynthesis. The encoded protein is synthesized as a precursor that is initially attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription. This cleaveage is inhibited by sterols. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative promoter usage and splicing result in multiple transcript variants, including SREBP-1a and SREBP-1c, which correspond to RefSeq transcript variants 2 and 3, respectively. [provided by RefSeq, Nov 2017]

Other Versions

Other products for "SREBF1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Mouse Monoclonal SREBP1 Antibody (2A4)
    • 100 ul

USD 457.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.