C6orf134 (ATAT1) (NM_001031722) Human Tagged ORF Clone

CAT#: RC208373

Reviews ()
Write a review

ATAT1 (Myc-DDK-tagged)-Human alpha tubulin acetyltransferase 1 (ATAT1), transcript variant 1



  "NM_001031722" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name C6orf134 (ATAT1) (NM_001031722) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATAT1
Synonyms alpha-TAT; alpha-TAT1; C6orf134; MEC17; Nbla00487; TAT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC208373 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGTTGACCTGGCCTTTCTGCTTCCTCACAATAACCTTAAGGGAGGAGGGAGTGTGCCACCTTGAAA
GTGTTGATCTACAGCAGCAAATTATGACCATTATAGATGAACTGGGCAAGGCTTCTGCCAAGGCCCAGAA
TCTTTCCGCTCCTATCACTAGTGCATCAAGGATGCAGAGTAACCGCCATGTTGTTTATATTCTCAAAGAC
AGTTCAGCCCGACCGGCTGGAAAAGGAGCCATTATTGGTTTCATCAAAGTTGGATACAAGAAGCTCTTTG
TACTGGATGATCGTGAGGCTCATAATGAGGTAGAACCACTTTGCATCCTGGACTTTTACATCCATGAGTC
TGTGCAACGCCATGGCCATGGGCGAGAACTCTTCCAGTATATGTTGCAGAAGGAGCGAGTGGAACCGCAC
CAACTGGCAATTGACCGACCCTCACAGAAGCTGCTGAAATTCCTGAATAAGCACTACAATCTGGAGACCA
CAGTCCCACAGGTGAACAACTTTGTGATCTTTGAAGGCTTCTTTGCCCATCAACATCGGCCCCCTGCTCC
CTCTCTGAGGGCAACTCGACACTCTCGTGCTGCTGCAGTCGATCCCACGCCCGCTGCTCCAGCAAGGAAG
CTGCCACCCAAGAGAGCAGAGGGAGACATCAAGCCATACTCCTCTAGTGACCGAGAATTTCTGAAGGTAG
CTGTGGAGCCTCCTTGGCCCCTAAACAGGGCCCCTCGCCGCGCCACACCTCCAGCCCACCCACCCCCCCG
CTCCAGCAGCCTGGGAAACTCACCAGAACGAGGTCCCCTCCGCCCCTTTGTGCCAGAGCAGGAGCTGCTG
CGTTCCTTGCGCCTCTGCCCCCCACACCCTACCGCCCGCCTTCTGTTGGCTGCTGACCCTGGGGGCAGCC
CAGCTCAACGTCGTCGCACCAGGGGGACTCCCCCAGGTCTGGTAGCCCAAAGCTGCTGCTACAGCCGCCA
TGGGGGGGTGAATTCCTCATCCCCCAATACAGGCAACCAAGACTCCAAGCAGGGAGAACAGGAAACAAAG
AATAGGTCTGCCAGTGAGGAGCAGGCCTTGTCACAGGATGGGTCTGGGGAGAAGCCCATGCACACAGCTC
CTCCACAGGCCCCGGCCCCGCCAGCCCAGTCCTGGACAGTGGGTGGGGACATACTCAACGCCAGGTTCAT
TCGAAACCTGCAGGAACGTCGCAGCACCAGGCCTTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208373 protein sequence
Red=Cloning site Green=Tags(s)

MWLTWPFCFLTITLREEGVCHLESVDLQQQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKD
SSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPH
QLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFEGFFAHQHRPPAPSLRATRHSRAAAVDPTPAAPARK
LPPKRAEGDIKPYSSSDREFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERGPLRPFVPEQELL
RSLRLCPPHPTARLLLAADPGGSPAQRRRTRGTPPGLVAQSCCYSRHGGVNSSSPNTGNQDSKQGEQETK
NRSASEEQALSQDGSGEKPMHTAPPQAPAPPAQSWTVGGDILNARFIRNLQERRSTRPW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001031722
ORF Size 1227 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001031722.1, NM_001031722.2, NM_001031722.3, NP_001026892.1
RefSeq Size 1740 bp
RefSeq ORF 1230 bp
Locus ID 79969
Cytogenetics 6p21.33
MW 45.6 kDa
Gene Summary This gene encodes a protein that localizes to clathrin-coated pits, where it acetylates alpha tubulin on lysine 40. This process may be important in microtubule growth, for instance during chemotaxis and the formation of cilium. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Citations (1)

Other Versions

Other products for "ATAT1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal anti-C6orf134 antibody
    • 100 ul

USD 310.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools