DDB1 (NM_001923) Human Tagged ORF Clone

CAT#: RC208372

Reviews ()
Write a review

DDB1 (Myc-DDK-tagged)-Human damage-specific DNA binding protein 1, 127kDa (DDB1)



  "NM_001923" in other vectors (6)

Reconstitution Protocol

USD 1,488.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "DDB1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DDB1
Synonyms DDBA; UV-DDB1; XAP1; XPCE; XPE; XPE-BF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208372 representing NM_001923
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTACAACTACGTGGTAACGGCCCAGAAGCCCACCGCCGTGAACGGCTGCGTGACCGGACACTTTA
CTTCGGCCGAAGACTTAAACCTGTTGATTGCCAAAAACACGAGATTAGAGATCTATGTGGTCACCGCCGA
GGGGCTTCGGCCCGTCAAAGAGGTGGGCATGTATGGGAAGATTGCGGTCATGGAGCTTTTCAGGCCCAAG
GGGGAGAGCAAGGACCTGCTGTTTATCTTGACAGCGAAGTACAATGCCTGCATCCTGGAGTATAAACAGA
GTGGCGAGAGCATTGACATCATTACGCGAGCCCATGGCAATGTCCAGGACCGCATTGGCCGCCCCTCAGA
GACCGGCATTATTGGCATCATTGACCCTGAGTGCCGGATGATTGGCCTGCGTCTCTATGATGGCCTTTTC
AAGGTTATTCCACTAGATCGCGATAATAAAGAACTCAAGGCCTTCAACATCCGCCTGGAGGAGCTGCATG
TCATTGATGTCAAGTTCCTATATGGTTGCCAAGCACCTACTATTTGCTTTGTCTACCAGGACCCTCAGGG
GCGGCACGTAAAAACCTATGAGGTGTCTCTCCGAGAAAAGGAATTCAATAAGGGCCCTTGGAAACAGGAA
AATGTCGAAGCTGAAGCTTCCATGGTGATCGCAGTCCCAGAGCCCTTTGGGGGGGCCATCATCATTGGAC
AGGAGTCAATCACCTATCACAATGGTGACAAATACCTGGCTATTGCCCCTCCTATCATCAAGCAAAGCAC
GATTGTGTGCCACAATCGAGTGGACCCTAATGGCTCAAGATACCTGCTGGGAGACATGGAAGGCCGGCTC
TTCATGCTGCTTTTGGAGAAGGAGGAACAGATGGATGGCACCGTCACTCTCAAGGATCTCCGTGTAGAAC
TCCTTGGAGAGACCTCTATTGCTGAGTGCTTGACATACCTTGATAATGGTGTTGTGTTTGTCGGGTCTCG
CCTGGGTGACTCCCAGCTTGTGAAGCTCAACGTTGACAGTAATGAACAAGGCTCCTATGTAGTGGCCATG
GAAACCTTTACCAACTTAGGACCCATTGTCGATATGTGCGTGGTGGACCTGGAGAGGCAGGGGCAGGGGC
AGCTGGTCACTTGCTCTGGGGCTTTCAAGGAAGGTTCTTTGCGGATCATCCGGAATGGAATTGGAATCCA
CGAGCATGCCAGCATTGACTTACCAGGCATCAAAGGATTATGGCCACTGCGGTCTGACCCTAATCGTGAG
ACTGATGACACTTTGGTGCTCTCTTTTGTGGGCCAGACAAGAGTTCTCATGTTAAATGGAGAGGAGGTAG
AAGAAACCGAACTGATGGGTTTCGTGGATGATCAGCAGACTTTCTTCTGTGGCAACGTGGCTCATCAGCA
GCTTATCCAGATCACTTCAGCATCGGTGAGGTTGGTCTCTCAAGAACCCAAAGCTCTGGTCAGTGAATGG
AAGGAGCCTCAGGCCAAGAACATCAGTGTGGCCTCCTGCAATAGCAGCCAGGTGGTGGTGGCTGTAGGCA
GGGCCCTCTACTATCTGCAGATCCATCCTCAGGAGCTCCGGCAGATCAGCCACACAGAGATGGAACATGA
AGTGGCTTGCTTGGACATCACCCCATTAGGAGACAGCAATGGACTGTCCCCTCTTTGTGCCATTGGCCTC
TGGACGGACATCTCGGCTCGTATCTTGAAGTTGCCCTCTTTTGAACTACTGCACAAGGAGATGCTGGGTG
GAGAGATCATTCCTCGCTCCATCCTGATGACCACCTTTGAGAGTAGCCATTACCTCCTTTGTGCCTTGGG
AGATGGAGCGCTTTTCTACTTTGGGCTCAACATTGAGACAGGTCTGTTGAGCGACCGTAAGAAGGTGACT
TTGGGCACCCAGCCCACCGTATTGAGGACTTTTCGTTCTCTTTCTACCACCAACGTCTTTGCTTGTTCTG
ACCGCCCCACTGTCATCTATAGCAGCAACCACAAATTGGTCTTCTCAAATGTCAACCTCAAGGAAGTGAA
CTACATGTGTCCCCTCAATTCAGATGGCTATCCTGACAGCCTGGCGCTGGCCAACAATAGCACCCTCACC
ATTGGCACCATCGATGAGATCCAGAAGCTGCACATTCGCACAGTTCCCCTCTATGAGTCTCCAAGGAAGA
TCTGCTACCAGGAAGTGTCCCAGTGTTTCGGGGTCCTCTCCAGCCGCATTGAAGTCCAAGACACGAGTGG
GGGCACGACAGCCTTGAGGCCCAGCGCTAGCACCCAGGCTCTGTCCAGCAGTGTAAGCTCCAGCAAGCTG
TTCTCCAGCAGCACTGCTCCTCATGAGACCTCCTTTGGAGAAGAGGTGGAGGTGCACAACCTACTTATCA
TTGACCAACACACCTTTGAAGTGCTTCATGCCCACCAGTTTCTGCAGAATGAATATGCCCTCAGTCTGGT
TTCCTGCAAGCTGGGCAAAGACCCCAACACTTACTTCATTGTGGGCACAGCAATGGTGTATCCTGAAGAG
GCAGAGCCCAAGCAGGGTCGCATTGTGGTCTTTCAGTATTCGGATGGAAAACTACAGACTGTGGCTGAAA
AGGAAGTGAAAGGGGCCGTGTACTCTATGGTGGAATTTAACGGGAAGCTGTTAGCCAGCATCAATAGCAC
GGTGCGGCTCTATGAGTGGACAACAGAGAAGGAGCTGCGCACTGAGTGCAACCACTACAACAACATCATG
GCCCTCTACCTGAAGACCAAGGGCGACTTCATCCTGGTGGGCGACCTTATGCGCTCAGTGCTGCTGCTTG
CCTACAAGCCCATGGAAGGAAACTTTGAAGAGATTGCTCGAGACTTTAATCCCAACTGGATGAGTGCTGT
GGAAATCTTGGATGATGACAATTTTCTGGGGGCTGAAAATGCCTTTAACTTGTTTGTGTGTCAAAAGGAT
AGCGCTGCCACCACTGACGAGGAGCGGCAGCACCTCCAGGAGGTTGGTCTTTTCCACCTGGGCGAGTTTG
TCAATGTCTTTTGCCACGGCTCTCTGGTAATGCAGAATCTGGGTGAGACTTCCACCCCCACACAAGGCTC
GGTGCTCTTCGGCACGGTCAACGGCATGATAGGGCTGGTGACCTCACTGTCAGAGAGCTGGTACAACCTC
CTGCTGGACATGCAGAATCGACTCAATAAAGTCATCAAAAGTGTGGGGAAGATCGAGCACTCCTTCTGGA
GATCCTTTCACACCGAGCGGAAGACAGAACCAGCCACAGGTTTCATCGACGGTGACTTGATTGAGAGTTT
CCTGGATATTAGCCGCCCCAAGATGCAGGAGGTGGTGGCAAACCTACAGTATGACGATGGCAGCGGTATG
AAGCGAGAGGCCACTGCAGACGACCTCATCAAGGTTGTGGAGGAGCTAACTCGGATCCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208372 representing NM_001923
Red=Cloning site Green=Tags(s)

MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPK
GESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLF
KVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQE
NVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRL
FMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAM
ETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEW
KEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVT
LGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLT
IGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKL
FSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIM
ALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKD
SAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNL
LLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001923
ORF Size 3420 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001923.5
RefSeq Size 4221 bp
RefSeq ORF 3423 bp
Locus ID 1642
UniProt ID Q16531
Cytogenetics 11q12.2
Domains CPSF_A
Protein Families Druggable Genome
Protein Pathways Nucleotide excision repair, Ubiquitin mediated proteolysis
MW 126.8 kDa
Gene Summary The protein encoded by this gene is the large subunit (p127) of the heterodimeric DNA damage-binding (DDB) complex while another protein (p48) forms the small subunit. This protein complex functions in nucleotide-excision repair and binds to DNA following UV damage. Defective activity of this complex causes the repair defect in patients with xeroderma pigmentosum complementation group E (XPE) - an autosomal recessive disorder characterized by photosensitivity and early onset of carcinomas. However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. The protein encoded by this gene also functions as an adaptor molecule for the cullin 4 (CUL4) ubiquitin E3 ligase complex by facilitating the binding of substrates to this complex and the ubiquitination of proteins. [provided by RefSeq, May 2012]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.