Cathepsin Z (CTSZ) (NM_001336) Human Tagged ORF Clone

CAT#: RC208341

CTSZ (Myc-DDK-tagged)-Human cathepsin Z (CTSZ)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_001336" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Anti-CTSZ Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00

Other products for "Cathepsin Z"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Cathepsin Z
Synonyms CTSX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208341 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAGGCGCGGGCCAGGGTGGCGGCCGCTTCTGCTGCTCGTGCTGCTGGCGGGCGCGGCGCAGGGCG
GCCTCTACTTCCGCCGGGGACAGACCTGCTACCGGCCTCTGCGGGGGGACGGGCTGGCTCCGCTGGGGCG
CAGCACATACCCCCGGCCTCATGAGTACCTGTCCCCAGCGGATCTGCCCAAGAGCTGGGACTGGCGCAAT
GTGGATGGTGTCAACTATGCCAGCATCACCCGGAACCAGCACATCCCCCAATACTGCGGCTCCTGCTGGG
CCCACGCCAGCACCAGCGCTATGGCGGATCGGATCAACATCAAGAGGAAGGGAGCGTGGCCCTCCACCCT
CCTGTCCGTGCAGAACGTCATCGACTGCGGTAACGCTGGCTCCTGTGAAGGGGGTAATGACCTGTCCGTG
TGGGACTACGCCCACCAGCACGGCATCCCTGACGAGACCTGCAACAACTACCAGGCCAAGGACCAGGAGT
GTGACAAGTTTAACCAATGTGGGACATGCAATGAATTCAAAGAGTGCCACGCCATCCGGAACTACACCCT
CTGGAGGGTGGGAGACTACGGCTCCCTCTCTGGGAGGGAGAAGATGATGGCAGAAATCTACGCAAATGGT
CCCATCAGCTGTGGAATAATGGCAACAGAAAGACTGGCTAACTACACCGGAGGCATCTATGCCGAATACC
AGGACACCACATATATAAACCATGTCGTTTCTGTGGCTGGGTGGGGCATCAGTGATGGGACTGAGTACTG
GATTGTCCGGAATTCATGGGGTGAACCATGGGGCGAGAGAGGCTGGCTGAGGATCGTGACCAGCACCTAT
AAGGATGGGAAGGGCGCCAGATACAACCTTGCCATCGAGGAGCACTGTACATTTGGGGACCCCATCGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208341 protein sequence
Red=Cloning site Green=Tags(s)

MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN
VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV
WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG
PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY
KDGKGARYNLAIEEHCTFGDPIV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001336
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001336.3
RefSeq Size 1517 bp
RefSeq ORF 912 bp
Locus ID 1522
UniProt ID Q9UBR2
Cytogenetics 20q13.32
Domains Pept_C1
Protein Families Druggable Genome, Protease
Protein Pathways Lysosome
MW 33.9 kDa
Gene Summary The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.