Deltex(DTX1) (NM_004416) Human Tagged ORF Clone

CAT#: RC208338

DTX1 (Myc-DDK-tagged)-Human deltex homolog 1 (Drosophila) (DTX1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Deltex(DTX1) (NM_004416) Human Tagged ORF Clone
Symbol DTX1
Synonyms hDx-1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208338 representing NM_004416
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACGGCCAGGCCACGGTGGGCTGATGCCTGTGAATGGTCTGGGCTTCCCACCGCAGAACGTGGCCC
GGGTGGTGGTGTGGGAGTGGCTGAATGAGCACAGCCGCTGGCGGCCCTACACGGCCACCGTGTGCCACCA
CATTGAGAACGTGCTGAAGGAGGACGCTCGCGGTTCCGTGGTCCTGGGGCAGGTGGACGCCCAGCTTGTG
CCCTACATCATCGACCTGCAGTCCATGCACCAGTTTCGCCAGGACACAGGCACCATGCGGCCCGTGCGGC
GCAACTTCTACGACCCGTCGTCGGCGCCGGGCAAGGGCATCGTGTGGGAGTGGGAGAACGACGGCGGCGC
ATGGACGGCCTACGATATGGACATCTGCATCACCATCCAGAACGCCTACGAGAAGCAGCACCCGTGGCTC
GACCTCTCATCGCTAGGCTTCTGCTACCTCATCTACTTCAACAGCATGTCGCAGATGAACCGCCAGACGC
GCCGGCGCCGCCGCCTGCGCCGCCGCCTGGACCTCGCCTACCCGCTCACCGTGGGCTCCATCCCTAAGTC
GCAGTCGTGGCCCGTGGGCGCCAGCTCGGGCCAGCCCTGCTCCTGCCAGCAGTGCCTGCTGGTCAACAGC
ACGCGCGCCGCCTCCAACGCCATCCTGGCCTCGCAGCGCCGCAAGGCGCCCCCCGCGCCCCCGCTGCCGC
CGCCGCCGCCACCTGGAGGGCCTCCAGGCGCGCTTGCCGTGCGCCCCAGCGCCACCTTCACAGGCGCCGC
GCTCTGGGCAGCGCCCGCCGCCGGCCCCGCCGAGCCCGCGCCGCCTCCCGGGGCGCCCCCACGGAGCCCG
GGCGCCCCCGGCGGAGCGCGCACCCCGGGGCAGAACAACCTCAACCGGCCCGGGCCCCAGCGCACCACCA
GCGTGAGCGCGCGCGCCTCCATCCCGCCGGGGGTCCCCGCACTCCCGGTGAAGAACTTGAATGGTACTGG
GCCGGTCCATCCGGCCCTGGCAGGGATGACCGGGATACTGCTGTGCGCGGCCGGGCTGCCCGTGTGCCTG
ACGCGGGCCCCCAAGCCCATCCTGCACCCGCCGCCCGTGAGCAAGAGCGACGTGAAGCCCGTGCCTGGCG
TGCCCGGGGTGTGCCGCAAGACCAAGAAGAAGCACCTTAAAAAGAGTAAGAATCCCGAGGATGTGGTTCG
AAGATACATGCAGAAGGTGAAAAACCCACCTGATGAGGACTGCACCATCTGCATGGAGCGACTGGTCACA
GCATCAGGCTACGAGGGCGTGCTTCGGCACAAGGGCGTGCGGCCTGAGCTCGTGGGCCGCCTGGGCCGCT
GTGGCCACATGTACCACCTGCTGTGCCTCGTGGCCATGTACTCCAATGGCAACAAGGATGGCAGCCTGCA
GTGCCCCACCTGCAAGGCCATCTACGGGGAGAAGACGGGTACGCAGCCGCCTGGGAAGATGGAGTTCCAC
CTCATCCCCCACTCGCTGCCCGGCTTCCCTGATACCCAGACCATCCGCATCGTCTATGACATCCCCACAG
GCATCCAGGGCCCTGAGCACCCCAACCCCGGGAAGAAGTTCACCGCAAGAGGATTCCCTCGCCACTGCTA
TCTACCCAACAACGAGAAAGGCCGGAAGGTGCTGCGGCTGCTCATCACGGCCTGGGAGAGAAGACTCATC
TTCACTATCGGCACGTCCAACACCACGGGCGAGTCGGACACCGTGGTGTGGAACGAGATCCACCACAAGA
CCGAGTTTGGATCCAACCTCACGGGCCACGGCTACCCGGACGCTAGCTACCTAGACAACGTGCTGGCTGA
GCTCACAGCCCAGGGCGTATCCGAGGCTGCAGCCAAGGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208338 representing NM_004416
Red=Cloning site Green=Tags(s)

MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLV
PYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWL
DLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQCLLVNS
TRAASNAILASQRRKAPPAPPLPPPPPPGGPPGALAVRPSATFTGAALWAAPAAGPAEPAPPPGAPPRSP
GAPGGARTPGQNNLNRPGPQRTTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCL
TRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVT
ASGYEGVLRHKGVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTGTQPPGKMEFH
LIPHSLPGFPDTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRLLITAWERRLI
FTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASYLDNVLAELTAQGVSEAAAKA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004416
ORF Size 1860 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004416.1, NM_004416.2, NP_004407
RefSeq Size 3317
RefSeq ORF 1863
Locus ID 1840
Cytogenetics 12q24.13
Domains RING, WWE
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Notch signaling pathway
MW 67.2 kDa
Gene Summary Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)