SV2A (NM_014849) Human Tagged ORF Clone

CAT#: RC208322

Reviews ()
Write a review

SV2A (Myc-DDK-tagged)-Human synaptic vesicle glycoprotein 2A (SV2A)



Reconstitution Protocol

USD 679.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SV2A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SV2A
Synonyms SV2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208322 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGAGGGCTTCCGAGACCGGGCAGCTTTCATCCGTGGGGCCAAAGACATTGCTAAGGAAGTCAAAA
AGCATGCGGCCAAGAAGGTGGTGAAGGGCCTGGACAGAGTCCAGGACGAATATTCCCGAAGATCGTACTC
CCGCTTTGAGGAGGAGGATGATGATGATGACTTCCCTGCTCCCAGTGATGGTTATTACCGAGGAGAAGGG
ACCCAGGATGAGGAGGAAGGTGGTGCATCCAGTGATGCTACTGAGGGCCATGACGAGGATGATGAGATCT
ATGAAGGGGAATATCAGGGCATTCCCCGGGCAGAGTCTGGGGGCAAAGGCGAGCGGATGGCAGATGGGGC
GCCCCTGGCTGGAGTAAGGGGGGGCTTGAGTGATGGGGAGGGTCCCCCTGGGGGCCGGGGGGAGGCACAA
CGACGGAAAGAACGAGAAGAACTGGCCCAACAGTATGAAGCCATCCTACGGGAGTGTGGCCACGGCCGCT
TCCAGTGGACACTGTATTTTGTGCTTGGTCTGGCGCTGATGGCTGACGGTGTGGAGGTCTTTGTGGTGGG
CTTCGTGCTGCCCAGCGCTGAGAAAGACATGTGCCTGTCCGACTCCAACAAAGGCATGCTAGGCCTCATC
GTCTACCTGGGCATGATGGTGGGAGCCTTCCTCTGGGGAGGTCTGGCTGACCGGCTGGGTCGGAGGCAGT
GTCTGCTCATCTCGCTCTCAGTCAACAGCGTCTTCGCCTTCTTCTCATCTTTTGTCCAGGGTTACGGCAC
TTTCCTCTTCTGCCGCCTACTTTCTGGGGTTGGGATTGGAGGGTCCATCCCCATTGTCTTCTCCTATTTC
TCCGAGTTTCTGGCCCAGGAGAAACGAGGGGAGCATTTGAGCTGGCTCTGCATGTTTTGGATGATTGGTG
GCGTGTACGCAGCTGCTATGGCCTGGGCCATCATCCCCCACTATGGGTGGAGTTTTCAGATGGGTTCTGC
CTACCAGTTCCACAGCTGGAGGGTCTTCGTCCTCGTCTGCGCCTTTCCTTCTGTGTTTGCCATTGGGGCT
CTGACCACGCAGCCTGAGAGCCCCCGTTTCTTCCTAGAGAATGGAAAGCATGATGAGGCCTGGATGGTGC
TGAAGCAGGTCCATGATACCAACATGCGAGCCAAAGGACATCCTGAGCGAGTGTTCTCAGTAACCCACAT
TAAGACGATTCATCAGGAGGATGAATTGATTGAGATCCAGTCGGACACAGGGACCTGGTACCAGCGCTGG
GGGGTCCGGGCCTTGAGCCTAGGGGGGCAGGTTTGGGGGAATTTTCTCTCCTGTTTTGGTCCCGAATATC
GGCGCATCACTCTGATGATGATGGGTGTGTGGTTCACCATGTCATTCAGCTACTATGGCCTGACCGTCTG
GTTTCCTGACATGATCCGCCATCTCCAGGCAGTGGACTACGCATCCCGCACCAAAGTGTTCCCCGGGGAG
CGCGTAGAGCATGTAACTTTTAACTTCACGTTGGAGAATCAGATCCACCGAGGCGGGCAGTACTTCAATG
ACAAGTTCATTGGGCTGCGGCTCAAGTCAGTGTCCTTTGAGGATTCCCTGTTTGAAGAGTGTTATTTTGA
GGATGTCACATCCAGCAACACGTTTTTCCGCAACTGCACATTCATCAACACTGTGTTCTATAACACTGAC
CTGTTCGAGTACAAGTTTGTGAACAGCCGTCTGATAAACAGTACATTCCTGCACAACAAGGAGGGCTGCC
CGCTAGACGTGACAGGGACGGGCGAAGGTGCCTACATGGTATACTTTGTGAGCTTCCTGGGGACACTGGC
AGTGCTTCCTGGGAATATCGTGTCTGCCCTGCTCATGGACAAGATCGGCAGGCTCAGAATGCTTGCTGGC
TCCAGCGTGATGTCCTGTGTCTCCTGCTTCTTCCTGTCTTTTGGGAACAGTGAGTCGGCCATGATCGCTC
TGCTCTGCCTTTTTGGCGGGGTCAGCATTGCATCCTGGAATGCGCTGGACGTGTTGACTGTTGAACTCTA
CCCCTCAGACAAGAGGACCACAGCTTTTGGCTTCCTGAATGCCCTGTGTAAGCTGGCAGCTGTGCTGGGG
ATCAGCATCTTCACATCCTTCGTGGGAATCACCAAGGCTGCACCCATCCTCTTTGCCTCAGCTGCCCTTG
CCCTTGGCAGCTCTCTGGCCCTGAAGCTGCCTGAGACCCGGGGGCAGGTGCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208322 protein sequence
Red=Cloning site Green=Tags(s)

MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEG
TQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQ
RRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLI
VYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYF
SEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGA
LTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGE
RVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTD
LFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAG
SSVMSCVSCFFLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLG
ISIFTSFVGITKAAPILFASAALALGSSLALKLPETRGQVLQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014849
ORF Size 2226 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014849.5
RefSeq Size 4428 bp
RefSeq ORF 2229 bp
Locus ID 9900
UniProt ID Q7L0J3
Cytogenetics 1q21.2
Domains sugar_tr
Protein Families Secreted Protein, Transmembrane
Protein Pathways ECM-receptor interaction
MW 82.7 kDa
Gene Summary The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons. [provided by RefSeq, Jun 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.