Cathepsin O(CTSO) (NM_001334) Human Tagged ORF Clone

CAT#: RC208268

CTSO (Myc-DDK-tagged)-Human cathepsin O (CTSO)

Need custom modification / cloning service?
Get a free quote

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Cathepsin O(CTSO) (NM_001334) Human Tagged ORF Clone
Symbol CTSO
Synonyms CTSO1; CTSO1
Vector pCMV6-Entry
Sequence Data
>RC208268 representing NM_001334
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTGCGGGCGCTGCCGTGGCTGCCGTGGCTGCTGTGGCTGCTGTGCCGGGGCGGCGGCGATGCGG
ACTCCCGCGCCCCCTTCACCCCGACCTGGCCGCGGAGCCGCGAGCGTGAAGCCGCCGCCTTCCGGGAAAG
TCTTAATAGACATCGATACTTGAATTCTTTATTTCCCAGTGAAAACTCCACCGCCTTCTATGGAATAAAT
CAGTTTTCCTATTTGTTTCCTGAAGAGTTTAAAGCCATTTATTTAAGAAGCAAACCTTCCAAGTTTCCCA
GATACTCAGCAGAAGTACATATGTCCATCCCCAATGTGTCTTTGCCGTTAAGATTTGACTGGAGGGACAA
GCAGGTTGTGACACAAGTGAGAAACCAGCAGATGTGTGGAGGATGCTGGGCCTTCAGCGTGGTGGGGGCA
GTGGAATCTGCTTATGCAATAAAGGGGAAGCCCCTGGAAGACCTAAGTGTCCAGCAGGTCATTGACTGTT
CGTATAATAATTATGGCTGCAATGGAGGCTCTACTCTCAATGCTTTGAACTGGTTAAACAAGATGCAAGT
AAAACTGGTGAAAGATTCAGAATATCCTTTTAAAGCACAAAATGGTCTGTGCCATTACTTTTCTGGTTCA
CATTCTGGATTTTCAATCAAAGGTTATTCTGCATATGACTTCAGTGACCAAGAAGATGAAATGGCAAAAG
CACTTCTTACCTTTGGCCCTTTGGTAGTCATAGTAGATGCAGTGAGCTGGCAAGATTATCTGGGAGGCAT
TATACAGCATCACTGCTCTAGTGGAGAAGCAAATCATGCAGTTCTCATAACTGGGTTTGATAAAACAGGA
AGCACTCCATATTGGATTGTGCGGAATTCCTGGGGAAGTTCTTGGGGAGTAGATGGTTATGCCCATGTCA
AAATGGGAAGTAATGTTTGTGGTATTGCAGATTCCGTTTCTTCTATATTTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208268 representing NM_001334
Red=Cloning site Green=Tags(s)

MDVRALPWLPWLLWLLCRGGGDADSRAPFTPTWPRSREREAAAFRESLNRHRYLNSLFPSENSTAFYGIN
QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGA
VESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGS
HSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTG
STPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001334
ORF Size 963 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001334.1, NM_001334.2, NP_001325
RefSeq Size 2943
RefSeq ORF 966
Locus ID 1519
Cytogenetics 4q32.1
Domains Peptidase_C1
Protein Families Protease, Druggable Genome
Protein Pathways Lysosome
MW 35.96 kDa
Gene Summary The protein encoded by the gene is a cysteine proteinase and a member of the papain superfamily. This proteolytic enzyme is involved in cellular protein degradation and turnover. The recombinant form of this enzyme was shown to degrade synthetic peptides typically used as substrates for cysteine proteinases and its proteolytic activity was abolished by an inhibitor of cyteine proteinase. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)