RNF144 (RNF144A) (NM_014746) Human Tagged ORF Clone

CAT#: RC208254

Reviews ()
Write a review

RNF144A (Myc-DDK-tagged)-Human ring finger protein 144A (RNF144A)



Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RNF144A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RNF144A
Synonyms hUIP4; RNF144; UBCE7IP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208254 representing NM_014746
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACAGCAAGGTACCGGCCCACCTGGGACCTGGCCCTCGACCCGCTGGTGTCTTGCAAGCTCTGTC
TTGGGGAGTACCCAGTGGAGCAGATGACAACCATAGCCCAGTGCCAATGCATCTTCTGTACTCTGTGCCT
GAAACAGTATGTTGAGCTCTTGATCAAAGAAGGATTAGAAACCGCAATTAGCTGCCCAGATGCTGCCTGC
CCTAAACAGGGCCACCTACAGGAGAACGAGATTGAGTGCATGGTTGCAGCTGAAATTATGCAAAGATATA
AAAAGCTACAATTTGAAAGAGAGGTGCTGTTTGATCCCTGTCGGACTTGGTGCCCGGCGTCCACCTGCCA
AGCTGTGTGTCAGCTCCAGGACGTGGGGCTGCAGACCCCCCAGCCAGTGCAGTGCAAAGCCTGCCGTATG
GAATTCTGCTCCACCTGCAAAGCCAGCTGGCACCCTGGCCAGGGCTGCCCGGAGACCATGCCGATCACCT
TCCTCCCCGGGGAGACCAGTGCTGCTTTCAAAATGGAAGAAGATGACGCGCCCATCAAGCGCTGCCCCAA
GTGCAAAGTCTACATCGAGCGAGACGAAGGCTGCGCGCAGATGATGTGCAAGAACTGCAAGCACGCCTTC
TGCTGGTACTGCCTGGAGTCTCTGGACGATGATTTCCTTCTGATACACTACGATAAGGGACCCTGCCGGA
ACAAGCTGGGCCACTCCCGGGCATCTGTGATCTGGCATCGGACACAGGTTGTGGGCATTTTTGCAGGATT
TGGGCTGCTGCTCTTGGTGGCCTCACCTTTCCTACTCCTGGCCACTCCCTTTGTACTTTGCTGCAAGTGC
AAGTGCAGTAAAGGTGACGACGACCCGTTACCCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208254 representing NM_014746
Red=Cloning site Green=Tags(s)

MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAAC
PKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRM
EFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAF
CWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKC
KCSKGDDDPLPT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014746
ORF Size 876 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014746.1
RefSeq Size 5755 bp
RefSeq ORF 879 bp
Locus ID 9781
UniProt ID P50876
Cytogenetics 2p25.1
Domains IBR
Protein Families Druggable Genome, Transmembrane
MW 32.7 kDa
Gene Summary This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq, Mar 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.