Pellino 1 (PELI1) (NM_020651) Human Tagged ORF Clone

CAT#: RC208197

Reviews ()
Write a review

PELI1 (Myc-DDK-tagged)-Human pellino homolog 1 (Drosophila) (PELI1)



  "NM_020651" in other vectors (6)

Reconstitution Protocol

USD 686.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PELI1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PELI1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208197 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTCTCCTGATCAAGAAAATCATCCATCTAAAGCACCAGTAAAATATGGTGAACTCATTGTCTTAG
GGTATAATGGGTCTCTCCCAAATGGCGATAGAGGAAGGAGGAAAAGTAGGTTTGCTTTGTTTAAAAGACC
TAAGGCAAATGGGGTGAAGCCCAGCACTGTGCATATTGCTTGTACTCCTCAGGCTGCAAAGGCAATAAGC
AACAAAGACCAGCATAGCATATCATATACTTTATCTCGGGCCCAGACTGTGGTGGTTGAATATACTCATG
ACAGCAACACCGATATGTTTCAGATTGGCCGGTCGACTGAAAGCCCCATTGATTTTGTAGTAACTGACAC
GGTTCCTGGAAGTCAAAGTAATTCTGATACACAGTCAGTACAAAGCACTATATCAAGATTTGCCTGCAGA
ATCATATGTGAACGGAATCCTCCCTTTACAGCACGGATTTATGCTGCAGGATTTGACTCATCAAAAAACA
TCTTTCTTGGGGAGAAGGCTGCCAAATGGAAGACATCAGATGGACAGATGGATGGCTTGACCACTAATGG
TGTTCTTGTGATGCATCCACGCAATGGGTTCACAGAAGACTCCAAGCCTGGAATATGGAGAGAAATATCG
GTGTGTGGAAATGTATTTAGCCTACGTGAAACCAGATCGGCTCAGCAGAGAGGAAAAATGGTGGAAATTG
AAACCAATCAGTTACAAGATGGCTCGTTAATTGACCTCTGTGGTGCAACATTGTTATGGCGTACTGCAGA
AGGCCTTTCCCACACTCCTACCGTGAAGCATTTAGAAGCTTTAAGACAGGAAATCAATGCAGCACGACCT
CAGTGCCCTGTAGGGTTCAACACACTAGCATTTCCTAGTATGAAGAGGAAAGACGTTGTAGATGAAAAAC
AACCATGGGTATATCTAAACTGCGGCCATGTACATGGCTATCATAACTGGGGAAACAAAGAAGAACGTGA
TGGAAAAGATCGTGAATGTCCTATGTGTAGGTCTGTTGGTCCCTATGTTCCTCTGTGGCTTGGATGTGAA
GCTGGATTTTATGTGGACGCCGGCCCTCCAACCCATGCGTTTAGCCCGTGTGGGCATGTGTGTTCAGAAA
AGACAACTGCCTATTGGTCCCAGATCCCACTTCCTCATGGTACTCATACTTTTCATGCAGCCTGTCCCTT
TTGTGCACATCAGTTGGCTGGTGAACAAGGCTACATCAGACTTATTTTTCAAGGACCTCTAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208197 protein sequence
Red=Cloning site Green=Tags(s)

MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS
NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR
IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS
VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARP
QCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCE
AGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020651
ORF Size 1254 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020651.4
RefSeq Size 3780 bp
RefSeq ORF 1257 bp
Locus ID 57162
UniProt ID Q96FA3
Cytogenetics 2p14
Domains Pellino
MW 46.3 kDa
Gene Summary E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation (PubMed:12496252, PubMed:17675297). Mediates 'Lys-48'-linked polyubiquitination of RIPK3 leading to its subsequent proteasome-dependent degradation; preferentially recognizes and mediates the degradation of the 'Thr-182' phosphorylated form of RIPK3 (PubMed:29883609). Negatively regulates necroptosis by reducing RIPK3 expression (PubMed:29883609). Mediates 'Lys-63'-linked ubiquitination of RIPK1 (PubMed:29883609).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.