ETV6(ETV6) (NM_001987) Human Tagged ORF Clone

CAT#: RC208185

ETV6 (Myc-DDK-tagged)-Human ets variant 6 (ETV6)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ETV6(ETV6) (NM_001987) Human Tagged ORF Clone
Symbol ETV6
Synonyms TEL; TEL/ABL; THC5
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208185 representing NM_001987
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGAGACTCCTGCTCAGTGTAGCATTAAGCAGGAACGAATTTCATATACACCTCCAGAGAGCCCAG
TGCCGAGTTACGCTTCCTCGACGCCACTTCATGTTCCAGTGCCTCGAGCGCTCAGGATGGAGGAAGACTC
GATCCGCCTGCCTGCGCACCTGCGCTTGCAGCCAATTTACTGGAGCAGGGATGACGTAGCCCAGTGGCTC
AAGTGGGCTGAAAATGAGTTTTCTTTAAGGCCAATTGACAGCAACACGTTTGAAATGAATGGCAAAGCTC
TCCTGCTGCTGACCAAAGAGGACTTTCGCTATCGATCTCCTCATTCAGGTGATGTGCTCTATGAACTCCT
TCAGCATATTCTGAAGCAGAGGAAACCTCGGATTCTTTTTTCACCATTCTTCCACCCTGGAAACTCTATA
CACACACAGCCGGAGGTCATACTGCATCAGAACCATGAAGAAGATAACTGTGTCCAGAGGACCCCCAGGC
CATCCGTGGATAATGTGCACCATAACCCTCCCACCATTGAACTGTTGCACCGCTCCAGGTCACCTATCAC
GACAAATCACCGGCCTTCTCCTGACCCCGAGCAGCGGCCCCTCCGGTCCCCCCTGGACAACATGATCCGC
CGCCTCTCCCCGGCTGAGAGAGCTCAGGGACCCAGGCCGCACCAGGAGAACAACCACCAGGAGTCCTACC
CTCTGTCAGTGTCTCCCATGGAGAATAATCACTGCCCAGCGTCCTCCGAGTCCCACCCGAAGCCATCCAG
CCCCCGGCAGGAGAGCACACGCGTGATCCAGCTGATGCCCAGCCCCATCATGCACCCTCTGATCCTGAAC
CCCCGGCACTCCGTGGATTTCAAACAGTCCAGGCTCTCCGAGGACGGGCTGCATAGGGAAGGGAAGCCCA
TCAACCTCTCTCATCGGGAAGACCTGGCTTACATGAACCACATCATGGTCTCTGTCTCCCCGCCTGAAGA
GCACGCCATGCCCATTGGGAGAATAGCAGACTGTAGACTGCTTTGGGATTACGTCTATCAGTTGCTTTCT
GACAGCCGGTACGAAAACTTCATCCGATGGGAGGACAAAGAATCCAAAATATTCCGGATAGTGGATCCCA
ACGGACTGGCTCGACTGTGGGGAAACCATAAGAACAGAACAAACATGACCTATGAGAAAATGTCCAGAGC
CCTGCGCCACTACTACAAACTAAACATTATCAGGAAGGAGCCAGGACAAAGGCTTTTGTTCAGGTTTATG
AAAACCCCAGATGAAATCATGAGTGGCCGAACAGACCGTCTGGAGCACCTAGAGTCCCAGGAGCTGGATG
AACAAATATACCAAGAAGATGAATGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208185 representing NM_001987
Red=Cloning site Green=Tags(s)

MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWL
KWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSI
HTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR
RLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILN
PRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLS
DSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001987
ORF Size 1356 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001987.1, NM_001987.2, NM_001987.3, NM_001987.4, NP_001978
RefSeq Size 5992
RefSeq ORF 1359
Locus ID 2120
Cytogenetics 12p13.2
Domains ETS, SAM_PNT
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Dorso-ventral axis formation
MW 52.8 kDa
Gene Summary This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma. [provided by RefSeq, Sep 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations