CRKL (NM_005207) Human Tagged ORF Clone

CAT#: RC208129

CRKL (Myc-DDK-tagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CRKL (NM_005207) Human Tagged ORF Clone
Symbol CRKL
Synonyms v-crk avian sarcoma virus CT10 oncogene homolog-like; v-crk sarcoma virus CT10 oncogene homolog (avian)-like
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208129 representing NM_005207
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCCGCCAGGTTCGACTCCTCGGACCGCTCCGCCTGGTATATGGGGCCGGTGTCTCGCCAGGAGG
CGCAGACCCGGCTCCAGGGCCAGCGCCACGGTATGTTCCTCGTCCGCGATTCTTCCACCTGCCCTGGGGA
CTATGTGCTGTCGGTGTCCGAGAACTCGCGGGTCTCCCACTACATCATCAACTCGCTGCCCAACCGCCGT
TTTAAGATCGGGGACCAGGAATTTGACCATTTGCCGGCCCTGCTGGAGTTTTACAAGATCCACTACCTGG
ACACCACCACCCTCATCGAGCCTGCGCCCAGGTATCCAAGCCCACCAATGGGATCTGTCTCAGCACCCAA
CCTGCCTACAGCAGAAGATAACCTGGAATATGTACGGACTCTGTATGATTTTCCTGGGAATGATGCCGAA
GACCTGCCCTTTAAAAAGGGTGAGATCCTAGTGATAATAGAGAAGCCTGAAGAACAGTGGTGGAGTGCCC
GGAACAAGGATGGCCGGGTTGGGATGATTCCTGTCCCTTATGTCGAAAAGCTTGTGAGATCCTCACCACA
CGGAAAGCATGGAAATAGGAATTCCAACAGTTATGGGATCCCAGAACCTGCTCATGCATACGCTCAACCT
CAGACCACAACTCCTCTACCTGCAGTTTCCGGTTCTCCTGGGGCAGCAATCACCCCTTTGCCATCCACAC
AGAATGGACCTGTCTTTGCGAAAGCAATCCAGAAAAGAGTACCCTGTGCTTATGACAAGACTGCCTTGGC
ATTAGAGGTTGGTGACATCGTGAAAGTCACAAGGATGAATATAAATGGCCAGTGGGAAGGCGAAGTGAAC
GGGCGCAAAGGGCTTTTCCCCTTTACGCACGTCAAAATCTTTGACCCTCAAAACCCAGATGAAAACGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208129 representing NM_005207
Red=Cloning site Green=Tags(s)

MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE
DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP
QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN
GRKGLFPFTHVKIFDPQNPDENE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005207
ORF Size 909 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005207.1, NM_005207.2, NM_005207.3, NP_005198
RefSeq Size 5235
RefSeq ORF 912
Locus ID 1399
Cytogenetics 22q11.21
Domains SH2, SH3
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, ErbB signaling pathway, Chemokine signaling pathway, Focal adhesion, Fc gamma R-mediated phagocytosis, Neurotrophin signaling pathway, Regulation of actin cytoskeleton, Insulin signaling pathway, Pathways in cancer, Renal cell carcinoma, Chronic myeloid leukemia
MW 33.6 kDa
Gene Summary This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.[provided by RefSeq, Jan 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)