HMGCS2 (NM_005518) Human Tagged ORF Clone

CAT#: RC208128

HMGCS2 (Myc-DDK-tagged)-Human 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HMGCS2 (NM_005518) Human Tagged ORF Clone
Symbol HMGCS2
Synonyms OTTHUMP00000013928; hydroxymethylglutaryl-CoA synthase 2; 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)
Vector pCMV6-Entry
Sequence Data
>RC208128 representing NM_005518
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCGTCTGTTGACTCCAGTGAAGCGCATTCTGCAACTGACAAGAGCGGTGCAGGAAACCTCCCTCA
CACCTGCTCGCCTGCTCCCAGTAGCCCACCAAAGGTTTTCTACAGCCTCTGCTGTCCCCCTGGCCAAAAC
AGATACTTGGCCAAAGGACGTGGGCATCCTGGCCCTGGAGGTCTACTTCCCAGCCCAATATGTGGACCAA
ACTGACCTGGAGAAGTATAACAATGTGGAAGCAGGAAAGTATACAGTGGGCTTGGGCCAGACCCGTATGG
GCTTCTGCTCAGTCCAAGAGGACATCAACTCCCTGTGCCTGACGGTGGTGCAACGGCTGATGGAGCGCAT
ACAGCTCCCATGGGACTCTGTGGGCAGGCTGGAAGTAGGCACTGAGACCATCATTGACAAGTCCAAAGCT
GTCAAAACAGTGCTCATGGAACTCTTCCAGGATTCAGGCAATACTGATATTGAGGGCATAGATACCACCA
ATGCCTGCTACGGTGGTACTGCCTCCCTCTTCAATGCTGCCAACTGGATGGAGTCCAGTTCCTGGGATGG
TCGTTATGCCATGGTGGTCTGTGGAGACATTGCCGTCTATCCCAGTGGTAATGCTCGTCCCACAGGTGGG
GCCGGAGCTGTGGCTATGCTGATTGGGCCCAAGGCCCCTCTGGCCCTGGAGCGAGGGCTGAGGGGAACCC
ATATGGAGAATGTGTATGACTTCTACAAACCAAATTTGGCCTCGGAGTACCCAATAGTGGATGGGAAGCT
TTCCATCCAGTGCTACTTGCGGGCCTTGGATCGATGTTACACATCATACCGTAAAAAAATCCAGAATCAG
TGGAAGCAAGCTGGCAGCGATCGACCCTTCACCCTTGACGATTTACAGTACATGATCTTTCATACACCCT
TTTGCAAGATGGTCCAGAAGTCTCTGGCTCGCCTGATGTTCAATGACTTCCTGTCAGCCAGCAGTGACAC
ACAAACCAGCTTATATAAGGGGCTGGAGGCTTTCGGGGGGCTAAAGCTGGAAGACACCTACACCAACAAG
GACCTGGATAAAGCACTTCTAAAGGCCTCTCAGGACATGTTCGACAAGAAAACCAAGGCTTCCCTTTACC
TCTCCACTCACAATGGGAACATGTACACCTCATCCCTGTACGGGTGCCTGGCCTCGCTTCTGTCCCACCA
CTCTGCCCAAGAACTGGCTGGCTCCAGGATTGGTGCCTTCTCTTATGGCTCTGGTTTAGCAGCAAGTTTC
TTTTCATTTCGAGTATCCCAGGATGCTGCTCCAGGCTCTCCCCTGGACAAGTTGGTGTCCAGCACATCAG
ACCTGCCAAAACGCCTAGCCTCCCGAAAGTGTGTGTCTCCTGAGGAGTTCACAGAAATAATGAACCAAAG
AGAGCAATTCTACCATAAGGTGAATTTCTCCCCACCTGGTGACACAAACAGCCTTTTCCCAGGTACTTGG
TACCTGGAGCGAGTGGACGAGCAGCATCGCCGAAAGTATGCCCGGCGTCCCGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208128 representing NM_005518
Red=Cloning site Green=Tags(s)

MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQ
TDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKA
VKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTGG
AGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQ
WKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNK
DLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTW
YLERVDEQHRRKYARRPV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005518
ORF Size 1524 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005518.1, NM_005518.2, NM_005518.3, NP_005509
RefSeq Size 2082
RefSeq ORF 1527
Locus ID 3158
Cytogenetics 1p12
Domains HMG_CoA_synt
Protein Families Druggable Genome
Protein Pathways Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation, Butanoate metabolism, Terpenoid backbone biosynthesis, Metabolic pathways, PPAR signaling pathway
MW 56.64 kDa
Gene Summary The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)