HBS1L (NM_006620) Human Tagged ORF Clone

CAT#: RC208125

Reviews ()
Write a review

HBS1L (Myc-DDK-tagged)-Human HBS1-like (S. cerevisiae) (HBS1L), transcript variant 1



  "NM_006620" in other vectors (5)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HBS1L
Synonyms EF-1a; eRF3c; ERFS; HBS1; HSPC276
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208125 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGGCATCGGAATGTTCGAGGCTATAACTACGATGAAGATTTTGAAGATGATGATCTCTACGGCC
AGTCTGTAGAGGATGATTATTGTATTTCGCCGTCAACAGCTGCTCAGTTTATTTATTCACGGCGTGACAA
ACCTTCCGTTGAGCCTGTGGAAGAATATGATTATGAAGATCTGAAAGAATCTTCCAATTCTGTTTCAAAC
CATCAGCTCAGTGGATTTGATCAAGCTCGTCTTTATTCATGCCTTGATCACATGAGAGAGGTACTTGGAG
ATGCTGTGCCAGATGAAATATTAATTGAAGCAGTTCTGAAGAACAAGTTTGATGTGCAGAAGGCTTTGTC
AGGGGTTCTGGAACAAGATAGAGTGCAGAGTTTGAAGGACAAGAATGAGGCAACAGTATCTACAGGAAAG
ATAGCAAAAGGAAAACCAGTAGATTCCCAGACATCGCGAAGTGAATCTGAAATTGTGCCAAAAGTTGCTA
AAATGACTGTATCTGGAAAGAAGCAAACTATGGGATTTGAAGTGCCTGGAGTATCTTCTGAAGAAAATGG
TCATAGTTTCCACACACCTCAAAAAGGACCGCCCATTGAAGATGCCATTGCTTCTTCCGATGTTCTTGAG
ACTGCTTCTAAATCTGCTAATCCACCCCACACGATTCAAGCATCAGAAGAGCAGAGTTCAACCCCAGCAC
CGGTGAAAAAGTCTGGCAAGCTGAGGCAGCAAATAGATGTGAAGGCGGAACTGGAGAAGCGGCAAGGAGG
GAAGCAGCTACTCAACTTAGTGGTCATTGGTCATGTTGATGCTGGGAAAAGTACTCTGATGGGCCATATG
CTTTATCTTCTGGGTAATATAAACAAAAGAACTATGCATAAGTATGAACAGGAGTCTAAAAAGGCTGGCA
AAGCTTCGTTTGCATATGCATGGGTCTTGGATGAAACTGGCGAAGAAAGGGAAAGGGGAGTAACCATGGA
TGTTGGTATGACAAAGTTTGAAACCACAACCAAAGTTATTACATTAATGGATGCTCCAGGCCATAAGGAC
TTCATTCCAAATATGATTACAGGAGCAGCCCAGGCGGATGTAGCTGTTTTAGTTGTAGATGCCAGCAGGG
GAGAGTTTGAAGCTGGATTTGAGACTGGAGGACAAACACGAGAGCATGGACTCTTGGTCCGTTCTCTGGG
AGTGACGCAGCTTGCAGTTGCAGTTAATAAAATGGATCAGGTTAATTGGCAACAAGAAAGGTTTCAAGAG
ATTACTGGAAAACTTGGGCACTTTCTTAAGCAAGCAGGTTTTAAGGAGAGTGATGTAGGTTTTATTCCTA
CAAGTGGTCTCAGTGGTGAAAATCTAATCACAAGATCTCAGTCAAGTGAACTCACAAAATGGTATAAAGG
ACTATGTTTATTAGAACAAATTGATTCCTTTAAGCCTCCCCAGCGATCTATTGACAAACCTTTTAGATTA
TGTGTGTCCGATGTTTTCAAAGATCAAGGATCTGGATTTTGCATAACTGGTAAAATAGAAGCTGGTTATA
TCCAAACTGGTGACCGACTACTGGCAATGCCTCCTAATGAAACTTGTACCGTGAAAGGAATCACTCTGCA
TGATGAACCTGTCGACTGGGCGGCAGCAGGCGATCATGTTAGTCTTACTTTGGTTGGGATGGATATCATC
AAAATCAATGTTGGCTGCATATTTTGTGGCCCCAAAGTACCCATTAAAGCTTGCACTCGTTTCAGAGCCC
GAATCCTCATCTTTAATATTGAAATTCCTATCACTAAAGGATTTCCTGTGCTGTTACACTACCAAACTGT
CAGTGAACCCGCCGTTATTAAACGATTGATTAGTGTCTTAAACAAAAGCACGGGTGAAGTCACAAAGAAA
AAGCCTAAGTTTTTGACTAAAGGCCAGAATGCATTGGTAGAGCTACAGACACAAAGACCAATAGCTCTTG
AGCTATATAAAGACTTTAAAGAGCTGGGGAGGTTCATGCTACGTTACGGTGGTTCTACAATAGCTGCTGG
TGTTGTCACTGAGATAAAAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208125 protein sequence
Red=Cloning site Green=Tags(s)

MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSN
HQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGK
IAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLE
TASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHM
LYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKD
FIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVNWQQERFQE
ITGKLGHFLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYKGLCLLEQIDSFKPPQRSIDKPFRL
CVSDVFKDQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDII
KINVGCIFCGPKVPIKACTRFRARILIFNIEIPITKGFPVLLHYQTVSEPAVIKRLISVLNKSTGEVTKK
KPKFLTKGQNALVELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEIKE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006620
ORF Size 2052 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006620.4
RefSeq Size 7163 bp
RefSeq ORF 2055 bp
Locus ID 10767
UniProt ID Q9Y450
Cytogenetics 6q23.3
Domains GTP_EFTU, GTP_EFTU_D3, GTP_EFTU_D2
MW 75.5 kDa
Gene Summary This gene encodes a member of the GTP-binding elongation factor family. It is expressed in multiple tissues with the highest expression in heart and skeletal muscle. The intergenic region of this gene and the MYB gene has been identified to be a quantitative trait locus (QTL) controlling fetal hemoglobin level, and this region influnces erythrocyte, platelet, and monocyte counts as well as erythrocyte volume and hemoglobin content. DNA polymorphisms at this region associate with fetal hemoglobin levels and pain crises in sickle cell disease. A single nucleotide polymorphism in exon 1 of this gene is significantly associated with severity in beta-thalassemia/Hemoglobin E. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, May 2009]

Other Versions

Other products for "HBS1L"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


HBS1L mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.