DCUN1D3 (NM_173475) Human Tagged ORF Clone

CAT#: RC208082

DCUN1D3 (Myc-DDK-tagged)-Human DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae) (DCUN1D3)

 Cited in 1 publication.

  View "NM_173475" in other vectors (10)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DCUN1D3 (NM_173475) Human Tagged ORF Clone
Symbol DCUN1D3
Synonyms 44M2.4; SCCRO3
Vector pCMV6-Entry
Sequence Data
>RC208082 representing NM_173475
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCAGTGTGTCACCAAGTGTAAGAATCCCTCATCGACCCTGGGCAGCAAAAATGGAGACCGTGAGC
CCAGCAACAAGTCACATAGCAGGCGGGGTGCAGGCCACCGTGAGGAGCAGGTACCACCCTGTGGCAAGCC
AGGTGGAGATATCCTCGTCAACGGGACCAAGAAGGCCGAGGCTGCCACTGAGGCCTGCCAGCTGCCAACG
TCCTCGGGAGATGCTGGGAGGGAGTCCAAGTCCAATGCCGAGGAGTCTTCCTTGCAAAGATTGGAAGAAC
TGTTCAGGCGCTACAAGGATGAGCGGGAAGATGCAATTTTGGAGGAAGGCATGGAGCGCTTTTGCAATGA
CCTGTGTGTTGACCCCACAGAATTTCGAGTGCTGCTCTTGGCTTGGAAGTTCCAGGCTGCAACCATGTGC
AAATTCACCAGGAAGGAGTTTTTTGATGGCTGCAAAGCAATAAGTGCAGACAGCATTGACGGAATCTGTG
CACGGTTCCCTAGCCTCTTAACAGAAGCCAAACAAGAGGATAAATTCAAGGATCTCTACCGGTTTACATT
TCAGTTTGGCCTGGACTCTGAAGAAGGGCAGCGGTCACTGCATCGGGAAATAGCCATTGCCCTGTGGAAA
CTAGTCTTTACCCAGAACAATCCTCCGGTATTGGACCAATGGCTAAACTTCCTAACAGAGAACCCCTCGG
GGATCAAGGGCATCTCCCGGGACACTTGGAACATGTTCCTTAACTTCACTCAGGTGATTGGCCCTGACCT
CAGCAACTACAGTGAAGATGAGGCCTGGCCAAGTCTCTTTGACACCTTTGTGGAGTGGGAAATGGAGCGA
AGGAAAAGAGAAGGGGAAGGGAGAGGTGCACTCAGCTCAGGGCCTGAGGGCTTGTGTCCCGAGGAGCAGA
CT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208082 representing NM_173475
Red=Cloning site Green=Tags(s)

MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT
SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC
KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK
LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER
RKREGEGRGALSSGPEGLCPEEQT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_173475
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_173475.1, NM_173475.2, NM_173475.3, NP_775746
RefSeq Size 3005
RefSeq ORF 915
Locus ID 123879
Cytogenetics 16p12.3
MW 34.1 kDa

Citations (1)

Other Versions

Other products for "DCUN1D3"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies