EMX1 (NM_004097) Human Tagged ORF Clone

CAT#: RC208006

EMX1 (Myc-DDK-tagged)-Human empty spiracles homeobox 1 (EMX1)

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EMX1 (NM_004097) Human Tagged ORF Clone
Symbol EMX1
Synonyms empty spiracles homolog 1; empty spiracles homeobox 1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208006 representing NM_004097
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCCTGGCTGGGTGCACACCCCGCAAGGCGGCGGCGCCAGGACGCGGAGCGCTCCCCAGAGCACGGC
TGCCTCGCACAGCTCCCGCGGCTGCGACCATGTTCCAGCCCGCGGCCAAGCGCGGCTTTACCATAGAGTC
CTTGGTGGCCAAGGACGGCGGCACCGGCGGGGGCACTGGCGGCGGGGGCGCGGGCTCCCATCTCCTGGCG
GCGGCCGCCTCCGAGGAACCGCTCCGGCCCACGGCGCTCAACTACCCTCACCCCAGCGCGGCCGAGGCGG
CCTTCGTGAGTGGCTTCCCTGCCGCGGCCGCCGCGGGCGCGGGCCGCTCGCTCTACGGTGGGCCCGAGCT
CGTGTTCCCCGAGGCCATGAACCACCCCGCGCTGACCGTGCATCCGGCGCACCAGCTGGGCGCCTCCCCG
CTGCAGCCCCCGCACTCCTTCTTCGGCGCCCAGCACCGGGACCCTCTCCATTTCTACCCCTGGGTCCTGC
GGAACCGCTTCTTCGGCCACCGCTTCCAGGCCAGCGACGTGCCCCAGGACGGGCTGCTTCTGCACGGCCC
CTTCGCACGCAAGCCCAAGCGGATCCGCACGGCCTTCTCGCCCTCGCAGCTGCTGCGGCTGGAGCGCGCC
TTCGAGAAGAACCACTACGTGGTGGGCGCCGAGCGGAAGCAGCTGGCCGGCAGTCTCAGCCTCTCCGAGA
CGCAGGTGAAGGTGTGGTTCCAGAACCGGAGGACAAAGTACAAACGGCAGAAGCTGGAGGAGGAAGGGCC
TGAGTCCGAGCAGAAGAAGAAGGGCTCCCATCACATCAACCGGTGGCGCATTGCCACGAAGCAGGCCAAT
GGGGAGGACATCGATGTCACCTCCAATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208006 representing NM_004097
Red=Cloning site Green=Tags(s)

MCLAGCTPRKAAAPGRGALPRARLPRTAPAAATMFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLA
AAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASP
LQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERA
FEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQAN
GEDIDVTSND

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004097
ORF Size 870 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004097.2, NP_004088
RefSeq Size 2188
RefSeq ORF 873
Locus ID 2016
Cytogenetics 2p13.2
Protein Families ES Cell Differentiation/IPS, Druggable Genome
MW 31.1 kDa
Gene Summary Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)