FAM20C (NM_020223) Human Tagged ORF Clone

CAT#: RC207945

FAM20C (Myc-DDK-tagged)-Human family with sequence similarity 20, member C (FAM20C)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FAM20C (NM_020223) Human Tagged ORF Clone
Symbol FAM20C
Synonyms DMP-4; DMP4; G-CK; GEF-CK; RNS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207945 representing NM_020223
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTTCCTGGTGGCCTGCGCGCTGCACATCGCCCTGGACCTGCTGCCCAGGCTGGAGCGACGCGGCG
CGCGGCCCTCGGGGGAGCCCGGCTGTTCGTGCGCGCAGCCCGCCGCCGAGGTGGCCGCGCCCGGCTGGGC
CCAGGTTCGGGGCCGCCCCGGGGAGCCCCCGGCCGCCTCCTCCGCCGCCGGCGACGCGGGCTGGCCCAAC
AAGCACACGCTCCGCATCCTGCAGGACTTCAGCTCCGACCCCTCCTCCAACCTCTCGTCCCACTCGCTGG
AGAAACTGCCGCCCGCGGCCGAGCCGGCCGAGCGCGCCTTGCGGGGGCGGGATCCCGGCGCCCTAAGACC
CCACGACCCCGCGCACCGGCCGCTGCTGCGAGACCCCGGCCCGCGTCGGTCCGAGTCGCCCCCCGGCCCC
GGCGGAGACGCCTCCCTCCTGGCCAGGCTGTTCGAGCACCCGCTTTACCGGGTGGCGGTTCCGCCGCTCA
CGGAGGAGGACGTCCTGTTCAATGTGAACAGCGACACCAGGCTCAGCCCCAAAGCGGCGGAGAACCCGGA
CTGGCCGCATGCGGGTGCTGAAGGTGCAGAATTCCTCTCCCCCGGGGAGGCGGCCGTGGACTCCTATCCC
AACTGGCTCAAGTTCCACATTGGTATCAACCGGTACGAGCTGTACTCCAGACACAACCCGGCCATCGAGG
CCCTGCTGCACGACCTCAGCTCCCAGAGGATCACCAGCGTGGCCATGAAGTCGGGGGGCACGCAGCTGAA
GCTCATCATGACCTTCCAGAATTACGGGCAAGCGCTGTTCAAACCCATGAAACAAACGAGGGAGCAGGAG
ACACCCCCTGACTTTTTTTATTTCTCTGACTACGAGAGGCACAATGCGGAGATTGCTGCCTTCCACCTGG
ACAGGATCCTGGACTTCCGCCGGGTCCCTCCCGTGGCCGGCAGGATGGTCAACATGACCAAGGAGATCCG
GGACGTCACACGGGACAAGAAGCTCTGGAGGACCTTCTTCATCTCTCCAGCCAACAACATCTGCTTCTAC
GGCGAGTGTTCCTACTACTGCTCCACGGAGCACGCCCTGTGCGGGAAGCCAGACCAGATCGAGGGCTCGC
TGGCGGCCTTCCTGCCCGACCTGTCCCTGGCCAAGAGGAAGACCTGGCGGAACCCTTGGCGGCGTTCCTA
CCACAAGCGCAAGAAGGCCGAGTGGGAGGTGGACCCTGACTACTGCGAGGAGGTGAAGCAGACACCGCCC
TACGACAGCAGCCACCGCATCCTGGACGTCATGGACATGACGATCTTCGACTTCCTCATGGGAAACATGG
ACCGTCACCACTACGAGACTTTTGAGAAGTTTGGGAATGAAACGTTCATCATCCACTTAGACAATGGAAG
AGGGTTTGGGAAGTATTCGCACGACGAGCTCTCCATCCTGGTGCCGCTACAGCAGTGCTGCAGGATCCGG
AAGTCCACCTACCTGCGTCTGCAGCTCCTGGCCAAGGAGGAGTACAAGCTGAGCCTGCTGATGGCCGAGT
CTCTGCGGGGGGACCAGGTGGCACCCGTGCTGTACCAGCCGCACCTGGAGGCCCTGGACCGGCGGCTCCG
CGTCGTGCTAAAGGCCGTCCGGGACTGCGTGGAGAGGAACGGGCTCCACAGCGTGGTGGATGACGACCTG
GACACTGAGCACAGAGCCGCCTCGGCGAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207945 representing NM_020223
Red=Cloning site Green=Tags(s)

MVFLVACALHIALDLLPRLERRGARPSGEPGCSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPN
KHTLRILQDFSSDPSSNLSSHSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGP
GGDASLLARLFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYP
NWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTREQE
TPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLWRTFFISPANNICFY
GECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPP
YDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIR
KSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVERNGLHSVVDDDL
DTEHRAASAR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020223
ORF Size 1710 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020223.1, NP_064608
RefSeq Size 2768
RefSeq ORF 1755
Locus ID 56975
Cytogenetics 7p22.3
Protein Families Secreted Protein, Transmembrane
MW 66.1 kDa
Gene Summary This gene encodes a member of the family of secreted protein kinases. The encoded protein binds calcium and phosphorylates proteins involved in bone mineralization. Mutations in this gene are associated with the autosomal recessive disorder Raine syndrome. [provided by RefSeq, Apr 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)