EHHADH (NM_001966) Human Tagged ORF Clone

CAT#: RC207928

EHHADH (Myc-DDK-tagged)-Human enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase (EHHADH), transcript variant 1

Change vector?

USD 1,103


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EHHADH (NM_001966) Human Tagged ORF Clone
Symbol EHHADH
Synonyms ECHD; FRTS3; L-PBE; LBFP; LBP; PBFE
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207928 representing NM_001966
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGTATACGCGGCTGCACAACGCCTTGGCGCTAATCCGCCTCCGAAACCCGCCGGTCAACGCGA
TCAGTACGACTTTACTCCGTGACATAAAAGAAGGACTACAGAAAGCTGTAATAGACCATACAATAAAAGC
CATTGTGATTTGTGGAGCAGAGGGCAAATTTTCTGCAGGTGCTGATATTCGTGGCTTCAGTGCTCCTAGG
ACATTTGGCCTTACACTGGGACATGTAGTAGATGAAATACAGAGAAATGAGAAGCCCGTGGTGGCAGCAA
TCCAAGGCATGGCTTTCGGAGGGGGACTAGAGCTGGCCCTGGGCTGTCACTATAGGATTGCCCACGCAGA
GGCTCAAGTTGGCTTACCAGAAGTTACACTGGGACTTCTCCCTGGTGCAAGAGGAACCCAGCTTCTCCCC
AGACTCACTGGAGTTCCTGCTGCACTTGACTTAATTACCTCAGGAAGACGTATTTTAGCAGATGAAGCAC
TCAAGCTGGGCATTCTAGATAAAGTTGTAAACTCAGACCCGGTTGAAGAAGCAATCAGATTTGCTCAGAG
AGTTTCAGATCAACCTCTAGAATCCCGTAGACTCTGCAACAAGCCAATTCAGAGCTTGCCCAACATGGAC
AGCATTTTTAGTGAGGCCCTCTTGAAGATGCGGAGGCAGCACCCTGGGTGTCTTGCACAGGAGGCTTGTG
TCCGTGCAGTCCAGGCTGCTGTGCAGTATCCCTATGAAGTGGGCATCAAGAAGGAGGAGGAGCTGTTTCT
ATATCTTTTGCAATCAGGGCAGGCTAGAGCCCTGCAATATGCTTTCTTCGCTGAAAGGAAAGCAAATAAG
TGGTCAACTCCCTCCGGAGCATCGTGGAAAACAGCATCAGCGCGGCCTGTCTCCTCAGTTGGTGTTGTTG
GCTTGGGAACAATGGGCCGAGGCATTGTCATTTCTTTTGCAAGGGCCAGGATTCCTGTGATTGCTGTAGA
CTCGGACAAAAACCAGCTAGCAACTGCAAACAAGATGATAACCTCTGTCTTGGAAAAAGAAGCCTCCAAA
ATGCAACAGAGCGGCCACCCTTGGTCAGGACCAAAACCCAGGTTAACTTCATCTGTGAAGGAGCTTGGTG
GTGTAGATTTAGTCATTGAAGCAGTATTTGAGGAAATGAGCCTGAAGAAGCAGGTCTTTGCTGAACTCTC
AGCTGTGTGCAAACCAGAAGCATTTTTGTGCACTAATACTTCAGCCCTGGATGTTGATGAGATTGCTTCT
TCCACTGATCGTCCTCACTTGGTCATTGGCACCCACTTCTTTTCGCCAGCTCATGTCATGAAGTTGTTAG
AGGTTATTCCCAGCCAATACTCTTCCCCCACTACCATTGCCACTGTTATGAACTTATCAAAAAAGATTAA
AAAGATTGGAGTCGTTGTAGGCAACTGTTTTGGATTTGTGGGGAATCGAATGTTGAATCCTTACTACAAT
CAGGCATATTTCTTGTTAGAAGAAGGCAGCAAACCAGAGGAGGTAGATCAGGTGCTGGAAGAGTTTGGTT
TTAAAATGGGACCTTTTAGAGTGTCTGATCTTGCTGGGTTGGATGTGGGCTGGAAATCTAGAAAGGGGCA
AGGTCTTACTGGACCTACATTGCTTCCAGGAACTCCTGCCCGAAAAAGGGGTAATAGGAGGTACTGCCCA
ATTCCTGATGTGCTCTGTGAATTAGGACGATTTGGCCAGAAGACAGGTAAGGGTTGGTATCAATATGACA
AGCCATTGGGTAGGATTCACAAACCTGATCCCTGGCTTTCCAAATTCCTATCACGGTATAGAAAAACCCA
TCACATTGAACCACGTACCATTAGCCAGGATGAGATCCTTGAACGCTGCTTATATTCACTTATCAATGAA
GCATTCCGTATCTTGGGAGAAGGGATAGCTGCTAGCCCAGAGCACATTGATGTTGTCTATTTACATGGAT
ATGGATGGCCAAGGCACAAGGGCGGGCCCATGTTCTATGCTTCCACAGTTGGGTTGCCCACAGTTCTAGA
GAAATTGCAGAAATATTACAGGCAGAACCCGGATATTCCCCAACTGGAGCCAAGTGACTATCTAAAAAAA
CTGGCTTCTCAGGGAAACCCTCCCCTGAAAGAATGGCAAAGCTTGGCAGGCTCCCCTAGCAGTAAATTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207928 representing NM_001966
Red=Cloning site Green=Tags(s)

MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGFSAPR
TFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLP
RLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMD
SIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANK
WSTPSGASWKTASARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASK
MQQSGHPWSGPKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYN
QAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCP
IPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINE
AFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKK
LASQGNPPLKEWQSLAGSPSSKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001966
ORF Size 2169 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001966.2, NM_001966.3, NP_001957
RefSeq Size 3821
RefSeq ORF 2172
Locus ID 1962
Cytogenetics 3q27.2
Domains ECH, 3HCDH, 3HCDH_N
Protein Pathways Fatty acid metabolism, Valine, leucine and isoleucine degradation, Lysine degradation, Tryptophan metabolism, beta-Alanine metabolism, Propanoate metabolism, Butanoate metabolism, Limonene and pinene degradation, Metabolic pathways, PPAR signaling pathway
MW 79.3 kDa
Gene Summary The protein encoded by this gene is a bifunctional enzyme and is one of the four enzymes of the peroxisomal beta-oxidation pathway. The N-terminal region of the encoded protein contains enoyl-CoA hydratase activity while the C-terminal region contains 3-hydroxyacyl-CoA dehydrogenase activity. Defects in this gene are a cause of peroxisomal disorders such as Zellweger syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations