EHHADH (NM_001966) Human Tagged ORF Clone

CAT#: RC207928

Reviews ()
Write a review

EHHADH (Myc-DDK-tagged)-Human enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase (EHHADH), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 907.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol EHHADH
Synonyms ECHD; FRTS3; L-PBE; LBFP; LBP; MFE1; PBFE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207928 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGTATACGCGGCTGCACAACGCCTTGGCGCTAATCCGCCTCCGAAACCCGCCGGTCAACGCGA
TCAGTACGACTTTACTCCGTGACATAAAAGAAGGACTACAGAAAGCTGTAATAGACCATACAATAAAAGC
CATTGTGATTTGTGGAGCAGAGGGCAAATTTTCTGCAGGTGCTGATATTCGTGGCTTCAGTGCTCCTAGG
ACATTTGGCCTTACACTGGGACATGTAGTAGATGAAATACAGAGAAATGAGAAGCCCGTGGTGGCAGCAA
TCCAAGGCATGGCTTTCGGAGGGGGACTAGAGCTGGCCCTGGGCTGTCACTATAGGATTGCCCACGCAGA
GGCTCAAGTTGGCTTACCAGAAGTTACACTGGGACTTCTCCCTGGTGCAAGAGGAACCCAGCTTCTCCCC
AGACTCACTGGAGTTCCTGCTGCACTTGACTTAATTACCTCAGGAAGACGTATTTTAGCAGATGAAGCAC
TCAAGCTGGGCATTCTAGATAAAGTTGTAAACTCAGACCCGGTTGAAGAAGCAATCAGATTTGCTCAGAG
AGTTTCAGATCAACCTCTAGAATCCCGTAGACTCTGCAACAAGCCAATTCAGAGCTTGCCCAACATGGAC
AGCATTTTTAGTGAGGCCCTCTTGAAGATGCGGAGGCAGCACCCTGGGTGTCTTGCACAGGAGGCTTGTG
TCCGTGCAGTCCAGGCTGCTGTGCAGTATCCCTATGAAGTGGGCATCAAGAAGGAGGAGGAGCTGTTTCT
ATATCTTTTGCAATCAGGGCAGGCTAGAGCCCTGCAATATGCTTTCTTCGCTGAAAGGAAAGCAAATAAG
TGGTCAACTCCCTCCGGAGCATCGTGGAAAACAGCATCAGCGCGGCCTGTCTCCTCAGTTGGTGTTGTTG
GCTTGGGAACAATGGGCCGAGGCATTGTCATTTCTTTTGCAAGGGCCAGGATTCCTGTGATTGCTGTAGA
CTCGGACAAAAACCAGCTAGCAACTGCAAACAAGATGATAACCTCTGTCTTGGAAAAAGAAGCCTCCAAA
ATGCAACAGAGCGGCCACCCTTGGTCAGGACCAAAACCCAGGTTAACTTCATCTGTGAAGGAGCTTGGTG
GTGTAGATTTAGTCATTGAAGCAGTATTTGAGGAAATGAGCCTGAAGAAGCAGGTCTTTGCTGAACTCTC
AGCTGTGTGCAAACCAGAAGCATTTTTGTGCACTAATACTTCAGCCCTGGATGTTGATGAGATTGCTTCT
TCCACTGATCGTCCTCACTTGGTCATTGGCACCCACTTCTTTTCGCCAGCTCATGTCATGAAGTTGTTAG
AGGTTATTCCCAGCCAATACTCTTCCCCCACTACCATTGCCACTGTTATGAACTTATCAAAAAAGATTAA
AAAGATTGGAGTCGTTGTAGGCAACTGTTTTGGATTTGTGGGGAATCGAATGTTGAATCCTTACTACAAT
CAGGCATATTTCTTGTTAGAAGAAGGCAGCAAACCAGAGGAGGTAGATCAGGTGCTGGAAGAGTTTGGTT
TTAAAATGGGACCTTTTAGAGTGTCTGATCTTGCTGGGTTGGATGTGGGCTGGAAATCTAGAAAGGGGCA
AGGTCTTACTGGACCTACATTGCTTCCAGGAACTCCTGCCCGAAAAAGGGGTAATAGGAGGTACTGCCCA
ATTCCTGATGTGCTCTGTGAATTAGGACGATTTGGCCAGAAGACAGGTAAGGGTTGGTATCAATATGACA
AGCCATTGGGTAGGATTCACAAACCTGATCCCTGGCTTTCCAAATTCCTATCACGGTATAGAAAAACCCA
TCACATTGAACCACGTACCATTAGCCAGGATGAGATCCTTGAACGCTGCTTATATTCACTTATCAATGAA
GCATTCCGTATCTTGGGAGAAGGGATAGCTGCTAGCCCAGAGCACATTGATGTTGTCTATTTACATGGAT
ATGGATGGCCAAGGCACAAGGGCGGGCCCATGTTCTATGCTTCCACAGTTGGGTTGCCCACAGTTCTAGA
GAAATTGCAGAAATATTACAGGCAGAACCCTGATATTCCCCAACTGGAGCCAAGTGACTATCTAAAAAAA
CTGGCTTCTCAGGGAAACCCTCCCCTGAAAGAATGGCAAAGCTTGGCAGGCTCCCCTAGCAGTAAATTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207928 protein sequence
Red=Cloning site Green=Tags(s)

MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGFSAPR
TFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLP
RLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMD
SIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANK
WSTPSGASWKTASARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASK
MQQSGHPWSGPKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYN
QAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCP
IPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINE
AFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKK
LASQGNPPLKEWQSLAGSPSSKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001966
ORF Size 2169 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001966.4
RefSeq Size 3870 bp
RefSeq ORF 2172 bp
Locus ID 1962
UniProt ID Q08426
Cytogenetics 3q27.2
Domains ECH, 3HCDH, 3HCDH_N
Protein Pathways beta-Alanine metabolism, Butanoate metabolism, Fatty acid metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, PPAR signaling pathway, Propanoate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation
MW 79.5 kDa
Gene Summary The protein encoded by this gene is a bifunctional enzyme and is one of the four enzymes of the peroxisomal beta-oxidation pathway. The N-terminal region of the encoded protein contains enoyl-CoA hydratase activity while the C-terminal region contains 3-hydroxyacyl-CoA dehydrogenase activity. Defects in this gene are a cause of peroxisomal disorders such as Zellweger syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Other products for "EHHADH"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.