HLTF (NM_003071) Human Tagged ORF Clone

CAT#: RC207920

HLTF (Myc-DDK-tagged)-Human helicase-like transcription factor (HLTF), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name HLTF (NM_003071) Human Tagged ORF Clone
Symbol HLTF
Synonyms HIP116; HIP116A; HLTF1; RNF80; SMARCA3; SNF2L3; ZBU1
Vector pCMV6-Entry
Sequence Data
>RC207920 representing NM_003071
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTGGATGTTCAAGAGGGATCCAGTTTGGAAGTACTTGCAGACTGTCCAGTATGGAGTTCATGGAA
ATTTTCCACGCCTCTCATATCCAACTTTCTTTCCACGTTTTGAATTCCAAGATGTTATCCCTCCAGATGA
CTTTCTAACTAGTGATGAAGAAGTAGATTCCGTTTTATTTGGAAGTTTGAGAGGTCATGTGGTTGGACTA
CGCTATTACACGGGAGTAGTTAATAATAATGAAATGGTTGCATTACAACGAGATCCTAATAACCCTTATG
ATAAGAATGCAATTAAAGTAAACAATGTGAATGGAAATCAAGTTGGCCATTTAAAGAAAGAGCTTGCAGG
TGCTTTGGCCTATATCATGGACAACAAATTGGCACAAATTGAAGGGGTAGTTCCTTTTGGTGCAAACAAT
GCTTTTACCATGCCTCTGCATATGACTTTTTGGGGAAAAGAAGAAAATAGAAAAGCGGTTTCAGATCAGT
TGAAGAAACATGGATTTAAATTGGGTCCTGCACCAAAAACTTTAGGATTCAATTTGGAAAGTGGTTGGGG
CTCTGGAAGAGCTGGACCAAGCTATAGTATGCCAGTGCATGCTGCAGTACAGATGACAACTGAACAGCTT
AAAACAGAATTTGACAAATTGTTTGAAGATTTAAAAGAAGATGATAAAACCCATGAAATGGAACCAGCTG
AGGCTATTGAAACACCACTGCTTCCACATCAAAAACAAGCTCTAGCTTGGATGGTGTCACGGGAAAATAG
CAAAGAACTTCCACCATTCTGGGAACAGCGAAATGACTTATACTATAACACAATAACAAATTTTTCTGAG
AAGGACCGACCAGAAAATGTCCATGGAGGAATTTTAGCTGATGATATGGGTTTGGGTAAAACTCTTACAG
CCATTGCAGTAATCCTTACCAACTTCCATGATGGCAGACCTCTTCCTATTGAAAGAGTTAAAAAGAATCT
ACTGAAGAAGGAATATAATGTTAACGATGACTCTATGAAACTTGGAGGAAACAATACCAGTGAAAAGGCA
GATGGACTAAGCAAAGACGCATCTAGATGTAGTGAACAACCCAGTATTTCAGATATCAAGGAGAAGAGTA
AGTTTCGCATGTCAGAATTGTCTAGCTCCCGCCCCAAAAGAAGAAAAACTGCTGTCCAGTACATAGAAAG
CAGTGATTCAGAGGAAATTGAAACAAGTGAATTGCCGCAGAAAATGAAAGGCAAACTGAAAAATGTACAG
TCTGAAACTAAAGGCAGGGCGAAAGGATCTTCTAAGGTTATAGAAGATGTGGCATTTGCATGTGCATTAA
CTTCATCTGTTCCTACAACAAAAAAGAAAATGTTGAAAAAGGGAGCTTGTGCAGTGGAGGGGTCAAAGAA
AACTGATGTTGAGGAGAGACCAAGAACAACACTGATCATCTGTCCGCTTTCTGTGTTAAGCAACTGGATT
GACCAGTTTGGACAACATATAAAATCAGATGTACACTTGAATTTTTATGTTTATTATGGTCCTGATCGTA
TTAGAGAACCGGCCTTACTTTCAAAACAGGATATTGTTTTGACTACGTATAATATTTTAACTCATGACTA
TGGAACTAAAGGAGATAGTCCATTACATAGCATAAGGTGGCTAAGAGTGATCCTGGATGAAGGACATGCC
ATACGAAATCCAAATGCTCAGCAGACAAAAGCTGTACTTGACTTAGAATCAGAAAGAAGATGGGTTTTGA
CAGGTACTCCAATCCAGAATTCTTTAAAGGACTTGTGGTCTCTTCTTTCCTTTTTAAAACTTAAACCATT
TATTGATAGAGAATGGTGGCATAGAACAATACAGCGTCCTGTCACAATGGGAGATGAAGGAGGACTTAGG
CGTTTACAGTCCCTAATTAAAAATATTACACTTAGAAGAACAAAGACAAGCAAAATTAAAGGAAAACCTG
TTTTGGAGTTACCAGAACGTAAAGTATTTATTCAGCACATTACACTTTCAGATGAAGAGAGAAAGATTTA
TCAGTCTGTGAAAAATGAAGGCAGAGCCACTATTGGAAGGTATTTTAATGAAGGGACTGTCCTGGCACAT
TATGCAGATGTCCTGGGTCTTTTGCTTAGACTGCGGCAAATTTGTTGCCATACTTACCTTCTTACAAATG
CAGTGTCTTCCAATGGCCCCTCAGGAAATGATACACCTGAAGAACTGAGAAAGAAGTTAATAAGGAAGAT
GAAGTTAATTCTGAGCTCAGGTTCAGATGAGGAATGTGCAATTTGCCTGGATTCTTTAACAGTTCCTGTG
ATAACACATTGTGCACATGTATTTTGTAAACCCTGTATTTGCCAAGTCATTCAGAATGAGCAGCCACATG
CTAAATGCCCTTTATGCAGAAATGATATACATGAAGATAATTTATTAGAATGTCCTCCAGAAGAATTAGC
ACGTGACAGTGAGAAAAAGTCTGATATGGAATGGACATCCAGTTCAAAGATTAATGCGCTAATGCACGCA
TTGACTGACTTAAGAAAGAAGAATCCCAACATAAAAAGTTTGGTTGTTTCTCAGTTTACAACATTCCTGT
CTTTAATAGAAATACCACTTAAAGCCTCTGGATTTGTGTTTACTCGTTTGGATGGTTCCATGGCCCAAAA
GAAAAGAGTTGAATCAATTCAGTGTTTTCAAAACACTGAAGCAGGATCTCCAACTATAATGCTTCTGTCC
TTAAAAGCAGGTGGAGTTGGTTTGAATCTGTCTGCAGCTTCTCGAGTGTTTTTAATGGATCCAGCCTGGA
ATCCTGCTGCTGAAGATCAGTGCTTTGACAGATGCCATAGACTTGGTCAGAAGCAAGAAGTTATCATCAC
AAAATTCATTGTAAAGGACTCTGTTGAAGAAAATATGCTGAAAATACAAAACAAAAAGAGAGAACTTGCA
GCAGGAGCCTTTGGAACTAAAAAACCAAATGCTGACGAAATGAAACAAGCCAAAATTAATGAAATCAGAA
CATTAATTGACTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207920 representing NM_003071
Red=Cloning site Green=Tags(s)

MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGL
RYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANN
AFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQL
KTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSE
KDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKA
DGLSKDASRCSEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQ
SETKGRAKGSSKVIEDVAFACALTSSVPTTKKKMLKKGACAVEGSKKTDVEERPRTTLIICPLSVLSNWI
DQFGQHIKSDVHLNFYVYYGPDRIREPALLSKQDIVLTTYNILTHDYGTKGDSPLHSIRWLRVILDEGHA
IRNPNAQQTKAVLDLESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGLR
RLQSLIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERKIYQSVKNEGRATIGRYFNEGTVLAH
YADVLGLLLRLRQICCHTYLLTNAVSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVPV
ITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMHA
LTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLS
LKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELA
AGAFGTKKPNADEMKQAKINEIRTLIDL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003071
ORF Size 3024 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003071.1, NM_003071.2, NM_003071.3, NP_003062
RefSeq Size 5351
RefSeq ORF 3030
Locus ID 6596
Cytogenetics 3q24
Domains SNF2_N, DEXDc, helicase_C, RING
Protein Families Transcription Factors, Druggable Genome
MW 113.7 kDa
Gene Summary This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)