GCLC (NM_001498) Human Tagged ORF Clone

CAT#: RC207915

Reviews ()
Write a review

GCLC (Myc-DDK-tagged)-Human glutamate-cysteine ligase, catalytic subunit (GCLC), transcript variant 1



Reconstitution Protocol

USD 593.00

In Stock*

Size
    • 10 ug

Product images

Other products for "GCLC"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GCLC
Synonyms GCL; GCS; GLCL; GLCLC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207915 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGCTGTCCCAGGGCTCGCCGCTGAGCTGGGAGGAAACCAAGCGCCATGCCGACCACGTGCGGC
GGCACGGGATCCTCCAGTTCCTGCACATCTACCACGCCGTCAAGGACCGGCACAAGGACGTTCTCAAGTG
GGGCGATGAGGTGGAATACATGTTGGTATCTTTTGATCATGAAAATAAAAAAGTCCGGTTGGTCCTGTCT
GGGGAGAAAGTTCTTGAAACTCTGCAAGAGAAGGGGGAAAGGACAAACCCAAACCATCCTACCCTTTGGA
GACCAGAGTATGGGAGTTACATGATTGAAGGGACACCAGGACAGCCCTACGGAGGAACAATGTCCGAGTT
CAATACAGTTGAGGCCAACATGCGAAAACGCCGGAAGGAGGCTACTTCTATATTAGAAGAAAATCAGGCT
CTTTGCACAATAACTTCATTTCCCAGATTAGGCTGTCCTGGGTTCACACTGCCCGAGGTCAAACCCAACC
CAGTGGAAGGAGGAGCTTCCAAGTCCCTCTTCTTTCCAGATGAAGCAATAAACAAGCACCCTCGCTTCAG
TACCTTAACAAGAAATATCCGACATAGGAGAGGAGAAAAGGTTGTCATCAATGTACCAATATTTAAGGAC
AAGAATACACCATCTCCATTTATAGAAACATTTACTGAGGATGATGAAGCTTCAAGGGCTTCTAAGCCGG
ATCATATTTACATGGATGCCATGGGATTTGGAATGGGCAATTGCTGTCTCCAGGTGACATTCCAAGCCTG
CAGTATATCTGAGGCCAGATACCTTTATGATCAGTTGGCTACTATCTGTCCAATTGTTATGGCTTTGAGT
GCTGCATCTCCCTTTTACCGAGGCTATGTGTCAGACATTGATTGTCGCTGGGGAGTGATTTCTGCATCTG
TAGATGATAGAACTCGGGAGGAGCGAGGACTGGAGCCATTGAAGAACAATAACTATAGGATCAGTAAATC
CCGATATGACTCAATAGACAGCTATTTATCTAAGTGTGGTGAGAAATATAATGACATCGACTTGACGATA
GATAAAGAGATCTACGAACAGCTGTTGCAGGAAGGCATTGATCATCTCCTGGCCCAGCATGTTGCTCATC
TCTTTATTAGAGACCCACTGACACTGTTTGAAGAGAAAATACACCTGGATGATGCTAATGAGTCTGACCA
TTTTGAGAATATTCAGTCCACAAATTGGCAGACAATGAGATTTAAGCCCCCTCCTCCAAACTCAGACATT
GGATGGAGAGTAGAATTTCGACCCATGGAGGTGCAATTAACAGACTTTGAGAACTCTGCCTATGTGGTGT
TTGTGGTACTGCTCACCAGAGTGATCCTTTCCTACAAATTGGATTTTCTCATTCCACTGTCAAAGGTTGA
TGAGAACATGAAGGTAGCACAGAAAAGAGATGCTGTCTTGCAGGGAATGTTTTATTTCAGGAAAGATATT
TGCAAAGGTGGCAATGCAGTGGTGGATGGTTGTGGCAAGGCCCAGAACAGCACGGAGCTCGCTGCAGAGG
AGTACACCCTCATGAGCATAGACACCATCATCAATGGGAAGGAAGGTGTGTTTCCTGGACTGATCCCAAT
TCTGAACTCTTACCTTGAAAACATGGAAGTGGATGTGGACACCAGATGTAGTATTCTGAACTACCTAAAG
CTAATTAAGAAGAGAGCATCTGGAGAACTAATGACAGTTGCCAGATGGATGAGGGAGTTTATCGCAAACC
ATCCTGACTACAAGCAAGACAGTGTCATAACTGATGAAATGAATTATAGCCTTATTTTGAAGTGTAACCA
AATTGCAAATGAATTATGTGAATGCCCAGAGTTACTTGGATCAGCATTTAGGAAAGTAAAATATAGTGGA
AGTAAAACTGACTCATCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207915 protein sequence
Red=Cloning site Green=Tags(s)

MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDHENKKVRLVLS
GEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMRKRRKEATSILEENQA
LCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAINKHPRFSTLTRNIRHRRGEKVVINVPIFKD
KNTPSPFIETFTEDDEASRASKPDHIYMDAMGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALS
AASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTI
DKEIYEQLLQEGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDI
CKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNSYLENMEVDVDTRCSILNYLK
LIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSG
SKTDSSN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001498
ORF Size 1911 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001498.4
RefSeq Size 3823 bp
RefSeq ORF 1914 bp
Locus ID 2729
UniProt ID P48506
Cytogenetics 6p12.1
Domains GCS
Protein Families Druggable Genome
Protein Pathways Glutathione metabolism, Metabolic pathways
MW 72.8 kDa
Gene Summary Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction.[provided by RefSeq, Oct 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.