Cardiotrophin 1 (CTF1) (NM_001330) Human Tagged ORF Clone

  • TrueORF®
SKU
RC207800
CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1
$289.00 $300.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cardiotrophin 1
Synonyms CT-1; CT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207800 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCGGAGGGAGGGAAGTCTGGAAGACCCCCAGACTGATTCCTCAGTCTCACTTCTTCCCCACTTGG
AGGCCAAGATCCGTCAGACACACAGCCTTGCGCACCTCCTCACCAAATACGCTGAGCAGCTGCTCCAGGA
ATATGTGCAGCTCCAGGGAGACCCCTTCGGGCTGCCCAGCTTCTCGCCGCCGCGGCTGCCGGTGGCCGGC
CTGAGCGCCCCGGCTCCGAGCCACGCGGGGCTGCCAGTGCACGAGCGGCTGCGGCTGGACGCGGCGGCGC
TGGCCGCGCTGCCCCCGCTGCTGGACGCAGTGTGTCGCCGCCAGGCCGAGCTGAACCCGCGCGCGCCGCG
CCTGCTGCGCCGCCTGGAGGACGCGGCGCGCCAGGCCCGGGCCCTGGGCGCCGCCGTGGAGGCCTTGCTG
GCCGCGCTGGGCGCCGCCAACCGCGGGCCCCGGGCCGAGCCCCCCGCCGCCACCGCCTCAGCCGCCTCCG
CCACCGGGGTCTTCCCCGCCAAGGTGCTGGGGCTCCGCGTTTGCGGCCTCTACCGCGAGTGGCTGAGCCG
CACCGAGGGCGACCTGGGCCAGCTGCTGCCCGGGGGCTCGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207800 protein sequence
Red=Cloning site Green=Tags(s)

MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAG
LSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALL
AALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001330
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001330.5
RefSeq Size 1681 bp
RefSeq ORF 606 bp
Locus ID 1489
UniProt ID Q16619
Cytogenetics 16p11.2
Protein Families ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
MW 21.2 kDa
Summary The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Dec 2008
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001330" in other vectors (4)
SKU Description Size Price
RC207800L3 Lenti-ORF clone of CTF1 (Myc-DDK-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1 10 ug
$600.00
RC207800L4 Lenti-ORF clone of CTF1 (mGFP-tagged)-Human cardiotrophin 1 (CTF1), transcript variant 1 10 ug
$600.00
RG207800 CTF1 (tGFP-tagged) - Human cardiotrophin 1 (CTF1), transcript variant 1 10 ug
$500.00
SC125788 CTF1 (untagged)-Human cardiotrophin 1 (CTF1), transcript variant 1 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.