GALNT6 (NM_007210) Human Tagged ORF Clone

CAT#: RC207728

GALNT6 (Myc-DDK-tagged)-Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GALNT6 (NM_007210) Human Tagged ORF Clone
Symbol GALNT6
Synonyms GALNAC-T6; GalNAcT6
Vector pCMV6-Entry
Sequence Data
>RC207728 representing NM_007210
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCTCCTCCGCAGACGCCACATGCCCCTGCGCCTGGCCATGGTGGGCTGCGCCTTTGTGCTCTTCC
TCTTCCTCCTGCATAGGGATGTGAGCAGCAGAGAGGAGGCCACAGAGAAGCCGTGGCTGAAGTCCCTGGT
GAGCCGGAAGGATCACGTCCTGGACCTCATGCTGGAGGCCATGAACAACCTTAGAGATTCAATGCCCAAG
CTCCAAATCAGGGCTCCAGAAGCCCAGCAGACTCTGTTCTCCATAAACCAGTCCTGCCTCCCTGGGTTCT
ATACCCCAGCTGAACTGAAGCCCTTCTGGGAACGGCCACCACAGGACCCCAATGCCCCTGGGGCAGATGG
AAAAGCATTTCAGAAGAGCAAGTGGACCCCCCTGGAGACCCAGGAAAAGGAAGAAGGCTATAAGAAGCAC
TGTTTCAATGCCTTTGCCAGCGACCGGATCTCCCTGCAGAGGTCCCTGGGGCCAGACACCCGACCACCTG
AGTGTGTGGACCAGAAGTTCCGGCGCTGCCCCCCACTGGCCACCACCAGCGTGATCATTGTGTTCCACAA
CGAAGCCTGGTCCACACTGCTGCGAACAGTGTACAGCGTCCTACACACCACCCCTGCCATCTTGCTCAAG
GAGATCATACTGGTGGATGATGCCAGCACAGAGGAGCACCTAAAGGAGAAGCTGGAGCAGTACGTGAAGC
AGCTGCAGGTGGTGAGGGTGGTGCGGCAGGAGGAGCGGAAGGGGCTGATCACCGCCCGGCTGCTGGGGGC
CAGCGTGGCACAGGCGGAGGTGCTCACGTTCCTGGATGCCCACTGTGAGTGCTTCCACGGCTGGCTGGAG
CCCCTCCTGGCTCGAATCGCTGAGGACAAGACAGTGGTGGTGAGCCCAGACATCGTCACCATCGACCTTA
ATACTTTTGAGTTCGCCAAGCCCGTCCAGAGGGGCAGAGTCCATAGCCGAGGCAACTTTGACTGGAGCCT
GACCTTCGGCTGGGAAACACTTCCTCCACATGAGAAGCAGAGGCGCAAGGATGAAACCTACCCCATCAAA
TCCCCGACGTTTGCTGGTGGCCTCTTCTCCATCTCCAAGTCCTACTTTGAGCACATCGGTACCTATGATA
ATCAGATGGAGATCTGGGGAGGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGTGGGGGCCAGCT
GGAGATCATCCCCTGCTCTGTCGTAGGCCATGTGTTCCGGACCAAGAGCCCCCACACCTTCCCCAAGGGC
ACTAGTGTCATTGCTCGCAATCAAGTGCGCCTGGCAGAGGTCTGGATGGACAGCTACAAGAAGATTTTCT
ATAGGAGAAATCTGCAGGCAGCAAAGATGGCCCAAGAGAAATCCTTCGGTGACATTTCGGAACGACTGCA
GCTGAGGGAACAACTGCACTGTCACAACTTTTCCTGGTACCTGCACAATGTCTACCCAGAGATGTTTGTT
CCTGACCTGACGCCCACCTTCTATGGTGCCATCAAGAACCTCGGCACCAACCAATGCCTGGATGTGGGTG
AGAACAACCGCGGGGGGAAGCCCCTCATCATGTACTCCTGCCACGGCCTTGGCGGCAACCAGTACTTTGA
GTACACAACTCAGAGGGACCTTCGCCACAACATCGCAAAGCAGCTGTGTCTACATGTCAGCAAGGGTGCT
CTGGGCCTTGGGAGCTGTCACTTCACTGGCAAGAATAGCCAGGTCCCCAAGGACGAGGAATGGGAATTGG
CCCAGGATCAGCTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCCCAGGACAAAAAGCCAGCCAT
GGCCCCCTGCAATCCCAGTGACCCCCATCAGTTGTGGCTCTTTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207728 representing NM_007210
Red=Cloning site Green=Tags(s)

MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRKDHVLDLMLEAMNNLRDSMPK
LQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEEGYKKH
CFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLK
EIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLE
PLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIK
SPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFV
PDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGA
LGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007210
ORF Size 1866 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007210.1, NM_007210.2, NM_007210.3, NP_009141
RefSeq Size 4520
RefSeq ORF 1869
Locus ID 11226
Cytogenetics 12q13.13
Domains RICIN, Glycos_transf_2
Protein Families Transmembrane
Protein Pathways O-Glycan biosynthesis, Metabolic pathways
MW 71 kDa
Gene Summary This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)