OriGene Logo

HB EGF (HBEGF) (NM_001945) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207688
HBEGF (Myc-DDK-tagged)-Human heparin-binding EGF-like growth factor (HBEGF)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Size
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags 30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA) 5 x 200 ul
$160.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each 100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug 10 ug
$650.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL 5 ml
$720.00

Other products for "HB EGF or NM_001945"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HB EGF
Synonyms DTR; DTS; DTSF; HEGFL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207688 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTGCTGCCGTCGGTGGTGCTGAAGCTCTTTCTGGCTGCAGTTCTCTCGGCACTGGTGACTGGCG
AGAGCCTGGAGCGGCTTCGGAGAGGGCTAGCTGCTGGAACCAGCAACCCGGACCCTCCCACTGTATCCAC
GGACCAGCTGCTACCCCTAGGAGGCGGCCGGGACCGGAAAGTCCGTGACTTGCAAGAGGCAGATCTGGAC
CTTTTGAGAGTCACTTTATCCTCCAAGCCACAAGCACTGGCCACACCAAACAAGGAGGAGCACGGGAAAA
GAAAGAAGAAAGGCAAGGGGCTAGGGAAGAAGAGGGACCCATGTCTTCGGAAATACAAGGACTTCTGCAT
CCATGGAGAATGCAAATATGTGAAGGAGCTCCGGGCTCCCTCCTGCATCTGCCACCCGGGTTACCATGGA
GAGAGGTGTCATGGGCTGAGCCTCCCAGTGGAAAATCGCTTATATACCTATGACCACACAACCATCCTGG
CCGTGGTGGCTGTGGTGCTGTCATCTGTCTGTCTGCTGGTCATCGTGGGGCTTCTCATGTTTAGGTACCA
TAGGAGAGGAGGTTATGATGTGGAAAATGAAGAGAAAGTGAAGTTGGGCATGACTAATTCCCAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207688 protein sequence
Red=Cloning site Green=Tags(s)

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLD
LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG
ERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001945
ORF Size 624 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001945.3
RefSeq Size 2381 bp
RefSeq ORF 627 bp
Locus ID 1839
UniProt ID Q99075
Cytogenetics 5q31.3
Domains EGF
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, GnRH signaling pathway
MW 23.1 kDa
Summary Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001945" in other vectors (6)
SKU Description Size Price
RC207688L1 Lenti ORF clone of Human heparin-binding EGF-like growth factor (HBEGF), Myc-DDK-tagged 10 ug
$600.00
RC207688L2 Lenti ORF clone of Human heparin-binding EGF-like growth factor (HBEGF), mGFP tagged 10 ug
$600.00
RC207688L3 Lenti ORF clone of Human heparin-binding EGF-like growth factor (HBEGF), Myc-DDK-tagged 10 ug
$600.00
RC207688L4 Lenti ORF clone of Human heparin-binding EGF-like growth factor (HBEGF), mGFP tagged 10 ug
$600.00
RG207688 HBEGF (tGFP-tagged) - Human heparin-binding EGF-like growth factor (HBEGF) 10 ug
$489.00 $500.00
SC108485 HBEGF (untagged)-Human heparin-binding EGF-like growth factor (HBEGF) 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.