D aspartate oxidase (DDO) (NM_003649) Human Tagged ORF Clone

CAT#: RC207622

Reviews ()
Write a review

DDO (Myc-DDK-tagged)-Human D-aspartate oxidase (DDO), transcript variant 1



  "NM_003649" in other vectors (6)

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name D aspartate oxidase (DDO) (NM_003649) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DDO
Synonyms DASOX; DDO-1; DDO-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC207622 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACCAGCCAGGCACTGGGAAACAAGGTTTGGTGCCAGAGATTTTGGTGGCTTCCAAGACTGCTTTT
TCAGAGACAGGCTCATGGACACAGCACGGATTGCAGTTGTCGGGGCAGGTGTGGTGGGGCTCTCCACGGC
TGTGTGCATCTCCAAACTGGTGCCCCGATGCTCCGTTACCATCATTTCAGACAAGTTTACTCCAGATACC
ACCAGTGATGTGGCAGCCGGAATGCTTATTCCTCACACTTATCCAGATACACCCATTCACACGCAGAAGC
AGTGGTTCAGAGAAACCTTTAATCACCTCTTTGCAATTGCCAATTCTGCAGAAGCTGGAGATGCTGGTGT
TCATTTGGTATCAGGTTGGCAGATATTTCAGAGCACTCCGACTGAAGAAGTGCCATTCTGGGCTGACGTG
GTTCTGGGATTTCGAAAGATGACTGAGGCTGAGCTGAAGAAATTCCCCCAGTATGTGTTTGGTCAGGCTT
TTACAACCCTGAAATGTGAATGCCCTGCCTACCTCCCGTGGTTGGAGAAAAGGATAAAGGGAAGTGGAGG
CTGGACACTCACTCGGCGAATAGAAGACCTGTGGGAACTTCATCCGTCCTTTGACATCGTGGTCAACTGT
TCAGGCCTTGGAAGCAGACAGCTTGCAGGAGACTCAAAGATTTTCCCTGTAAGGGGCCAAGTCCTCCAAG
TTCAGGCTCCCTGGGTGGAGCATTTTATCCGAGATGGCAGTGGGCTGACATATATTTATCCTGGTACATC
CCATGTAACCCTAGGTGGAACTAGGCAAAAAGGGGACTGGAATCTGTCCCCGGATGCAGAAAATAGCAGA
GAGATTCTTTCCCGATGCTGTGCTCTGGAGCCCTCCCTCCACGGAGCCTGCAACATCAGGGAGAAGGTGG
GCTTGAGGCCCTACAGGCCAGGCGTGCGACTGCAGACAGAGCTCCTTGCGCGAGATGGACAGAGGCTGCC
TGTAGTCCACCACTATGGCCATGGGAGTGGGGGCATCTCAGTGCACTGGGGCACTGCTCTGGAGGCCGCC
AGGCTGGTGAGCGAGTGTGTCCATGCCCTCAGGACCCCCATTCCCAAGTCAAACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207622 protein sequence
Red=Cloning site Green=Tags(s)

MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDT
TSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV
VLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNC
SGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSR
EILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAA
RLVSECVHALRTPIPKSNL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003649
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003649.3
RefSeq Size 1733 bp
RefSeq ORF 1110 bp
Locus ID 8528
Cytogenetics 6q21
Domains DAO
Protein Pathways Alanine, aspartate and glutamate metabolism
MW 41 kDa
Gene Summary The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2019]

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-DDO Antibody
    • 100 ul

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools