GPNMB (NM_001005340) Human Tagged ORF Clone

CAT#: RC207615

GPNMB (Myc-DDK-tagged)-Human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPNMB (NM_001005340) Human Tagged ORF Clone
Symbol GPNMB
Synonyms HGFIN; NMB
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207615 representing NM_001005340
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAATGTCTCTACTATTTCCTGGGATTTCTGCTCCTGGCTGCAAGATTGCCACTTGATGCCGCCAAAC
GATTTCATGATGTGCTGGGCAATGAAAGACCTTCTGCTTACATGAGGGAGCACAATCAATTAAATGGCTG
GTCTTCTGATGAAAATGACTGGAATGAAAAACTCTACCCAGTGTGGAAGCGGGGAGACATGAGGTGGAAA
AACTCCTGGAAGGGAGGCCGTGTGCAGGCGGTCCTGACCAGTGACTCACCAGCCCTCGTGGGCTCAAATA
TAACATTTGCGGTGAACCTGATATTCCCTAGATGCCAAAAGGAAGATGCCAATGGCAACATAGTCTATGA
GAAGAACTGCAGAAATGAGGCTGGTTTATCTGCTGATCCGTATGTTTACAACTGGACAGCATGGTCAGAG
GACAGTGACGGGGAAAATGGCACCGGCCAAAGCCATCATAACGTCTTCCCTGATGGGAAACCTTTTCCTC
ACCACCCCGGATGGAGAAGATGGAATTTCATCTACGTCTTCCACACACTTGGTCAGTATTTCCAGAAATT
GGGACGATGTTCAGTGAGAGTTTCTGTGAACACAGCCAATGTGACACTTGGGCCTCAACTCATGGAAGTG
ACTGTCTACAGAAGACATGGACGGGCATATGTTCCCATCGCACAAGTGAAAGATGTGTACGTGGTAACAG
ATCAGATTCCTGTGTTTGTGACTATGTTCCAGAAGAACGATCGAAATTCATCCGACGAAACCTTCCTCAA
AGATCTCCCCATTATGTTTGATGTCCTGATTCATGATCCTAGCCACTTCCTCAATTATTCTACCATTAAC
TACAAGTGGAGCTTCGGGGATAATACTGGCCTGTTTGTTTCCACCAATCATACTGTGAATCACACGTATG
TGCTCAATGGAACCTTCAGCCTTAACCTCACTGTGAAAGCTGCAGCACCAGGACCTTGTCCGCCACCGCC
ACCACCACCCAGACCTTCAAAACCCACCCCTTCTTTAGCAACTACTCTAAAATCTTATGATTCAAACACC
CCAGGACCTGCTGGTGACAACCCCCTGGAGCTGAGTAGGATTCCTGATGAAAACTGCCAGATTAACAGAT
ATGGCCACTTTCAAGCCACCATCACAATTGTAGAGGGAATCTTAGAGGTTAACATCATCCAGATGACAGA
CGTCCTGATGCCGGTGCCATGGCCTGAAAGCTCCCTAATAGACTTTGTCGTGACCTGCCAAGGGAGCATT
CCCACGGAGGTCTGTACCATCATTTCTGACCCCACCTGCGAGATCACCCAGAACACAGTCTGCAGCCCTG
TGGATGTGGATGAGATGTGTCTGCTGACTGTGAGACGAACCTTCAATGGGTCTGGGACGTACTGTGTGAA
CCTCACCCTGGGGGATGACACAAGCCTGGCTCTCACGAGCACCCTGATTTCTGTTCCTGACAGAGACCCA
GCCTCGCCTTTAAGGATGGCAAACAGCGCCCTGATCTCCGTTGGCTGCTTGGCCATATTTGTCACTGTGA
TCTCCCTCTTGGTGTACAAAAAACACAAGGAATACAACCCAATAGAAAATAGTCCTGGGAATGTGGTCAG
AAGCAAAGGCCTGAGTGTCTTTCTCAACCGTGCAAAAGCCGTGTTCTTCCCGGGAAACCAGGAAAAGGAT
CCGCTACTCAAAAACCAAGAATTTAAAGGAGTTTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207615 representing NM_001005340
Red=Cloning site Green=Tags(s)

MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWK
NSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSE
DSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEV
TVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTIN
YKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNT
PGPAGDNPLELSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTSTLISVPDRDP
ASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKD
PLLKNQEFKGVS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001005340
ORF Size 1716 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001005340.1, NP_001005340
RefSeq Size 2775
RefSeq ORF 1719
Locus ID 10457
Cytogenetics 7p15.3
Protein Families Transmembrane, Druggable Genome
MW 63.92 kDa
Gene Summary The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations