GPR65 (NM_003608) Human Tagged ORF Clone

CAT#: RC207600

Reviews ()
Write a review

GPR65 (Myc-DDK-tagged)-Human G protein-coupled receptor 65 (GPR65)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GPR65
Synonyms hTDAG8; TDAG8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207600 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAGCACATGTATTGAAGAACAGCATGACCTGGATCACTATTTGTTTCCCATTGTTTACATCTTTG
TGATTATAGTCAGCATTCCAGCCAATATTGGATCTCTGTGTGTGTCTTTCCTGCAAGCAAAGAAGGAAAG
TGAACTAGGAATTTACCTCTTCAGTTTGTCACTATCAGATTTACTCTATGCATTAACTCTCCCTTTATGG
ATTGATTATACTTGGAATAAAGACAACTGGACTTTCTCTCCTGCCTTGTGCAAAGGGAGTGCTTTTCTCA
TGTACATGAATTTTTACAGCAGCACAGCATTCCTCACCTGCATTGCCGTTGATCGGTATTTGGCTGTTGT
CTACCCTTTGAAGTTTTTTTTCCTAAGGACAAGAAGATTTGCACTCATGGTCAGCCTGTCCATCTGGATA
TTGGAAACCATCTTCAATGCTGTCATGTTGTGGGAAGATGAAACAGTTGTTGAATATTGCGATGCCGAAA
AGTCTAATTTTACTTTATGCTATGACAAATACCCTTTAGAGAAATGGCAAATCAACCTCAACTTGTTCAG
GACGTGTACAGGCTATGCAATACCTTTGGTCACCATCCTGATCTGCAACCGGAAAGTCTACCAAGCTGTG
CGGCACAATAAAGCCACGGAAAACAAGGAAAAGAAGAGAATCATAAAACTACTTGTCAGCATCACAGTTA
CTTTTGTCTTATGCTTTACTCCCTTTCATGTGATGTTGCTGATTCGCTGCATTTTAGAGCATGCTGTGAA
CTTCGAAGACCACAGCAATTCTGGGAAGCGAACTTACACAATGTATAGAATCACGGTTGCATTAACAAGT
TTAAATTGTGTTGCTGATCCAATTCTGTACTGTTTTGTAACCGAAACAGGAAGATATGATATGTGGAATA
TATTAAAATTCTGCACTGGGAGGTGTAATACATCACAAAGACAAAGAAAACGCATACTTTCTGTGTCTAC
AAAAGATACTATGGAATTAGAGGTCCTTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207600 protein sequence
Red=Cloning site Green=Tags(s)

MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSDLLYALTLPLW
IDYTWNKDNWTFSPALCKGSAFLMYMNFYSSTAFLTCIAVDRYLAVVYPLKFFFLRTRRFALMVSLSIWI
LETIFNAVMLWEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAV
RHNKATENKEKKRIIKLLVSITVTFVLCFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTS
LNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003608
ORF Size 1011 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003608.2, NP_003599.2
RefSeq Size 4522 bp
RefSeq ORF 1014 bp
Locus ID 8477
UniProt ID Q8IYL9
Cytogenetics 14q31.3
Protein Families Druggable Genome, GPCR, Transmembrane
MW 39.3 kDa
Gene Summary Receptor for the glycosphingolipid psychosine (PSY) and several related glycosphingolipids (PubMed:11309421). Plays a role in immune response by maintaining lysosome function and supporting phagocytosis-mediated intracellular bacteria clearance (PubMed:27287411). May have a role in activation-induced cell death or differentiation of T-cells (By similarity).[UniProtKB/Swiss-Prot Function]
Other products for "GPR65"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.