Peripherin (PRPH) (NM_006262) Human Tagged ORF Clone

CAT#: RC207561

Reviews ()
Write a review

PRPH (Myc-DDK-tagged)-Human peripherin (PRPH)



  "NM_006262" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRPH
Synonyms NEF4; PRPH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207561 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCACCACCCGTCGGGCCTCCGGGCCGGCTTCAGCTCCACCTCATACCGCCGTACCTTCGGTCCAC
CGCCCTCACTATCCCCCGGGGCCTTCTCCTACTCGTCCAGCTCCCGCTTCTCCAGCAGCCGCCTGCTGGG
CTCCGCGTCCCCGAGCTCCTCGGTGCGCCTGGGCAGCTTCCGTAGCCCCCGAGCGGGAGCGGGCGCCCTC
CTGCGCCTGCCCTCGGAGCGCCTCGACTTCTCCATGGCCGAGGCCCTCAACCAGGAGTTCCTGGCCACGC
GCAGCAACGAGAAGCAGGAGCTGCAGGAGCTCAACGACCGCTTCGCCAACTTCATCGAGAAGGTACGCTT
TCTGGAGCAGCAGAACGCGGCCCTGCGCGGGGAGCTGAGCCAAGCCCGGGGCCAGGAGCCGGCGCGCGCC
GACCAGCTGTGCCAGCAGGAGCTGCGCGAGCTGCGGCGAGAGCTGGAGCTGTTGGGCCGCGAGCGTGACC
GGGTGCAGGTGGAGCGCGACGGGCTGGCGGAGGACCTGGCGGCGCTCAAGCAGAGGTTGGAGGAGGAGAC
GCGCAAGCGGGAGGACGCGGAGCACAACCTCGTGCTCTTCCGCAAGGACGTGGACGATGCCACTCTGTCC
CGCCTGGAACTAGAGCGCAAGATTGAGTCTCTGATGGATGAGATTGAGTTCCTCAAGAAGCTGCACGAGG
AGGAGCTGCGAGACCTGCAGGTGAGTGTGGAGAGCCAGCAGGTGCAGCAGGTGGAGGTGGAAGCCACGGT
GAAGCCCGAGCTGACGGCAGCGCTGAGGGACATCCGCGCGCAGTACGAGAGCATCGCCGCGAAGAACCTG
CAGGAGGCGGAGGAGTGGTACAAGTCCAAGTACGCGGACCTGTCCGACGCTGCCAACCGGAACCACGAGG
CCCTGCGCCAGGCCAAGCAGGAGATGAACGAGTCCCGACGCCAGATCCAGAGTCTAACGTGCGAGGTGGA
CGGGCTGCGCGGCACGAACGAGGCGCTGCTCAGGCAGTTGAGAGAGCTGGAGGAGCAGTTCGCCCTGGAG
GCGGGGGGCTACCAGGCGGGCGCTGCGCGGCTCGAGGAGGAGCTGCGACAGCTAAAAGAGGAGATGGCGC
GGCACCTGAGGGAGTACCAGGAGCTCCTCAACGTCAAGATGGCCCTGGACATCGAGATCGCCACCTACCG
CAAGCTGCTGGAGGGCGAGGAGAGCCGGATCTCCGTGCCCGTCCATTCTTTTGCCTCCTTAAATATAAAG
ACGACTGTGCCTGAGGTGGAGCCTCCCCAGGACAGCCACAGCCGGAAGACGGTTCTGATCAAGACCATTG
AGACCCGGAATGGGGAGGTGGTGACAGAGTCCCAGAAGGAGCAGCGCAGTGAGCTGGACAAGTCTTCTGC
CCACAGTTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207561 protein sequence
Red=Cloning site Green=Tags(s)

MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGAL
LRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQEPARA
DQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLFRKDVDDATLS
RLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNL
QEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALE
AGGYQAGAARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK
TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006262
ORF Size 1410 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006262.4
RefSeq Size 1833 bp
RefSeq ORF 1413 bp
Locus ID 5630
UniProt ID P41219
Cytogenetics 12q13.12
Protein Pathways Amyotrophic lateral sclerosis (ALS)
MW 53.7 kDa
Gene Summary This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PRPH"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


PRPH mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.