Calcium independent Phospholipase A2 (PLA2G6) (NM_003560) Human Tagged ORF Clone

CAT#: RC207546

Reviews ()
Write a review

PLA2G6 (Myc-DDK-tagged)-Human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1



Reconstitution Protocol

USD 738.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PLA2G6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PLA2G6
Synonyms CaI-PLA2; GVI; INAD1; iPLA2; IPLA2-VIA; iPLA2beta; NBIA2; NBIA2A; NBIA2B; PARK14; PLA2; PNPLA9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207546 representing NM_003560
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTTCTTTGGCCGCCTGGTCAATACCTTCAGTGGCGTCACCAACTTGTTCTCTAACCCATTCCGGG
TGAAGGAGGTGGCTGTGGCCGACTACACCTCGAGTGACCGAGTTCGGGAGGAAGGGCAGCTGATTCTGTT
CCAGAACACTCCCAACCGCACCTGGGACTGCGTCCTGGTCAACCCCAGGAACTCACAGAGTGGATTCCGA
CTCTTCCAGCTGGAGTTGGAGGCTGACGCCCTAGTGAATTTCCATCAGTATTCTTCCCAGCTGCTACCCT
TCTATGAGAGCTCCCCTCAGGTCCTGCACACTGAGGTCCTGCAGCACCTGACCGACCTCATCCGTAACCA
CCCCAGCTGGTCAGTGGCCCACCTGGCTGTGGAGCTAGGGATCCGCGAGTGCTTCCATCACAGCCGTATC
ATCAGCTGTGCCAATTGCGCGGAGAACGAGGAGGGCTGCACACCCCTGCACCTGGCCTGCCGCAAGGGTG
ATGGGGAGATCCTGGTGGAGCTGGTGCAGTACTGCCACACTCAGATGGATGTCACCGACTACAAGGGAGA
GACCGTCTTCCATTATGCTGTCCAGGGTGACAATTCTCAGGTGCTGCAGCTCCTTGGAAGGAACGCAGTG
GCTGGCCTGAACCAGGTGAATAACCAAGGGCTGACCCCGCTGCACCTGGCCTGCCAGCTGGGGAAGCAGG
AGATGGTCCGCGTGCTGCTGCTGTGCAATGCTCGGTGCAACATCATGGGCCCCAACGGCTACCCCATCCA
CTCGGCCATGAAGTTCTCTCAGAAGGGGTGTGCGGAGATGATCATCAGCATGGACAGCAGCCAGATCCAC
AGCAAAGACCCCCGTTACGGAGCCAGCCCCCTCCACTGGGCCAAGAACGCAGAGATGGCCCGCATGCTGC
TGAAACGGGGCTGCAACGTGAACAGCACCAGCTCCGCGGGGAACACGGCCCTGCACGTGGCGGTGATGCG
CAACCGCTTCGACTGTGCCATAGTGCTGCTGACCCACGGGGCCAACGCGGATGCCCGCGGAGAGCACGGC
AACACCCCGCTGCACCTGGCCATGTCGAAAGACAACGTGGAGATGATCAAGGCCCTCATCGTGTTCGGAG
CAGAAGTGGACACCCCGAATGACTTTGGGGAGACTCCTACATTCCTAGCCTCCAAAATCGGCAGACTTGT
CACCAGGAAGGCGATCTTGACTCTGCTGAGAACCGTGGGGGCCGAATACTGCTTCCCACCCATCCACGGG
GTCCCCGCGGAGCAGGGCTCTGCAGCGCCACATCATCCCTTCTCCCTGGAAAGAGCTCAGCCCCCACCGA
TCAGCCTAAACAACCTAGAACTACAGGATCTCATGCACATCTCACGGGCCCGGAAGCCAGCGTTCATCCT
GGGCTCCATGAGGGACGAGAAGCGGACCCACGACCACCTGCTGTGCCTGGATGGAGGAGGAGTGAAAGGC
CTCATCATCATCCAGCTCCTCATCGCCATCGAGAAGGCCTCGGGTGTGGCCACCAAGGACCTGTTTGACT
GGGTGGCGGGCACCAGCACTGGAGGCATCCTGGCCCTGGCCATTCTGCACAGTAAGTCCATGGCCTACAT
GCGCGGCATGTACTTTCGCATGAAGGATGAGGTGTTCCGGGGCTCCAGGCCCTACGAGTCGGGGCCCCTG
GAGGAGTTCCTGAAGCGGGAGTTTGGGGAGCACACCAAGATGACGGACGTCAGGAAACCCAAGGTGATGC
TGACAGGGACACTGTCTGACCGGCAGCCGGCTGAACTCCACCTCTTCCGGAACTACGATGCTCCAGAAAC
TGTCCGGGAGCCTCGTTTCAACCAGAACGTTAACCTCAGGCCTCCAGCTCAGCCCTCAGACCAGCTGGTG
TGGCGGGCGGCCCGAAGCAGCGGGGCAGCTCCTACTTACTTCCGACCCAATGGGCGCTTCCTGGACGGTG
GGCTGCTGGCCAACAACCCCACGCTGGATGCCATGACCGAGATCCATGAGTACAATCAGGACCTGATCCG
CAAGGGTCAGGCCAACAAGGTGAAGAAACTCTCCATCGTTGTCTCCCTGGGGACAGGGAGGTCCCCACAA
GTGCCTGTGACCTGTGTGGATGTCTTCCGTCCCAGCAACCCCTGGGAGCTGGCCAAGACTGTTTTTGGGG
CCAAGGAACTGGGCAAGATGGTGGTGGACTGTTGCACGGATCCAGACGGGCGGGCTGTGGACCGGGCACG
GGCCTGGTGCGAGATGGTCGGCATCCAGTACTTCAGATTGAACCCCCAGCTGGGGACGGACATCATGCTG
GATGAGGTCAGTGACACAGTGCTGGTCAACGCCCTCTGGGAGACCGAGGTCTACATCTATGAGCACCGCG
AGGAGTTCCAGAAGCTCATCCAGCTGCTGCTCTCACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207546 representing NM_003560
Red=Cloning site Green=Tags(s)

MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR
LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI
ISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV
AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH
SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG
NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG
VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKG
LIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPL
EEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLV
WRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQ
VPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIML
DEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003560
ORF Size 2418 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003560.4
RefSeq Size 3239 bp
RefSeq ORF 2421 bp
Locus ID 8398
UniProt ID O60733
Cytogenetics 22q13.1
Protein Pathways alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway
MW 89.7 kDa
Gene Summary The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date. [provided by RefSeq, Dec 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.