CYBB(CYBB) (NM_000397) Human Tagged ORF Clone

CAT#: RC207544

CYBB (Myc-DDK-tagged)-Human cytochrome b-245, beta polypeptide (CYBB)

Change vector?

  • TrueORF®

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CYBB(CYBB) (NM_000397) Human Tagged ORF Clone
Symbol CYBB
Synonyms AMCBX2; CGD; GP91-1; GP91-PHOX; GP91PHOX; IMD34; NOX2; p91-PHOX
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207544 representing NM_000397
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAACTGGGCTGTGAATGAGGGGCTCTCCATTTTTGTCATTCTGGTTTGGCTGGGGTTGAACGTCT
TCCTCTTTGTCTGGTATTACCGGGTTTATGATATTCCACCTAAGTTCTTTTACACAAGAAAACTTCTTGG
GTCAGCACTGGCACTGGCCAGGGCCCCTGCAGCCTGCCTGAATTTCAACTGCATGCTGATTCTCTTGCCA
GTCTGTCGAAATCTGCTGTCCTTCCTCAGGGGTTCCAGTGCGTGCTGCTCAACAAGAGTTCGAAGACAAC
TGGACAGGAATCTCACCTTTCATAAAATGGTGGCATGGATGATTGCACTTCACTCTGCGATTCACACCAT
TGCACATCTATTTAATGTGGAATGGTGTGTGAATGCCCGAGTCAATAATTCTGATCCTTATTCAGTAGCA
CTCTCTGAACTTGGAGACAGGCAAAATGAAAGTTATCTCAATTTTGCTCGAAAGAGAATAAAGAACCCTG
AAGGAGGCCTGTACCTGGCTGTGACCCTGTTGGCAGGCATCACTGGAGTTGTCATCACGCTGTGCCTCAT
ATTAATTATCACTTCCTCCACCAAAACCATCCGGAGGTCTTACTTTGAAGTCTTTTGGTACACACATCAT
CTCTTTGTGATCTTCTTCATTGGCCTTGCCATCCATGGAGCTGAACGAATTGTACGTGGGCAGACCGCAG
AGAGTTTGGCTGTGCATAATATAACAGTTTGTGAACAAAAAATCTCAGAATGGGGAAAAATAAAGGAATG
CCCAATCCCTCAGTTTGCTGGAAACCCTCCTATGACTTGGAAATGGATAGTGGGTCCCATGTTTCTGTAT
CTCTGTGAGAGGTTGGTGCGGTTTTGGCGATCTCAACAGAAGGTGGTCATCACCAAGGTGGTCACTCACC
CTTTCAAAACCATCGAGCTACAGATGAAGAAGAAGGGGTTCAAAATGGAAGTGGGACAATACATTTTTGT
CAAGTGCCCAAAGGTGTCCAAGCTGGAGTGGCACCCTTTTACACTGACATCCGCCCCTGAGGAAGACTTC
TTTAGTATCCATATCCGCATCGTTGGGGACTGGACAGAGGGGCTGTTCAATGCTTGTGGCTGTGATAAGC
AGGAGTTTCAAGATGCGTGGAAACTACCTAAGATAGCGGTTGATGGGCCCTTTGGCACTGCCAGTGAAGA
TGTGTTCAGCTATGAGGTGGTGATGTTAGTGGGAGCAGGGATTGGGGTCACACCCTTCGCATCCATTCTC
AAGTCAGTCTGGTACAAATATTGCAATAACGCCACCAATCTGAAGCTCAAAAAGATCTACTTCTACTGGC
TGTGCCGGGACACACATGCCTTTGAGTGGTTTGCAGATCTGCTGCAACTGCTGGAGAGCCAGATGCAGGA
AAGGAACAATGCCGGCTTCCTCAGCTACAACATCTACCTCACTGGCTGGGATGAGTCTCAGGCCAATCAC
TTTGCTGTGCACCATGATGAGGAGAAAGATGTGATCACAGGCCTGAAACAAAAGACTTTGTATGGACGGC
CCAACTGGGATAATGAATTCAAGACAATTGCAAGTCAACACCCTAATACCAGAATAGGAGTTTTCCTCTG
TGGACCTGAAGCCTTGGCTGAAACCCTGAGTAAACAAAGCATCTCCAACTCTGAGTCTGGCCCTCGGGGA
GTGCATTTCATTTTCAACAAGGAAAACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207544 representing NM_000397
Red=Cloning site Green=Tags(s)

MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLP
VCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVA
LSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH
LFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLY
LCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDF
FSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANH
FAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG
VHFIFNKENF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000397
ORF Size 1710 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000397.2, NM_000397.3, NP_000388
RefSeq Size 4266
RefSeq ORF 1713
Locus ID 1536
Cytogenetics Xp21.1-p11.4
Domains Ferric_reduct
Protein Families Ion Channels: Other, Transmembrane, Druggable Genome
Protein Pathways Leukocyte transendothelial migration
MW 65.2 kDa
Gene Summary Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.