CTRP4 (C1QTNF4) (NM_031909) Human Tagged ORF Clone

CAT#: RC207458

Reviews ()
Write a review

C1QTNF4 (Myc-DDK-tagged)-Human C1q and tumor necrosis factor related protein 4 (C1QTNF4)



  "NM_031909" in other vectors (7)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol C1QTNF4
Synonyms CTRP4; ZACRP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207458 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCGCTTCTGCTGGGCCTGCTGGGCCCAGCGGCCTGCTGGGCCCTGGGCCCGACCCCCGGCCCGG
GATCCTCTGAGCTGCGCTCGGCCTTCTCGGCGGCACGCACCACCCCCCTGGAGGGCACGTCGGAGATGGC
GGTGACCTTCGACAAGGTGTACGTGAACATCGGGGGCGACTTCGATGTGGCCACCGGCCAGTTTCGCTGC
CGCGTGCCCGGCGCCTACTTCTTCTCCTTCACGGCTGGCAAGGCCCCGCACAAGAGCCTGTCGGTGATGC
TGGTGCGAAACCGCGACGAGGTGCAGGCGCTGGCCTTCGACGAGCAGCGGCGGCCAGGCGCGCGGCGCGC
AGCCAGCCAGAGCGCCATGCTGCAGCTCGACTACGGCGACACAGTGTGGCTGCGGCTGCATGGCGCCCCG
CAGTACGCGCTAGGCGCGCCCGGCGCCACCTTCAGCGGCTACCTAGTCTACGCCGACGCCGACGCTGACG
CGCCTGCGCGCGGGCCGCCCGCGCCCCCCGAGCCGCGCTCGGCCTTCTCGGCGGCGCGCACGCGCAGCTT
GGTGGGCTCGGACGCTGGCCCCGGGCCGCGGCACCAACCACTCGCCTTCGACACCGAGTTCGTCAACATT
GGCGGCGACTTCGACGCGGCGGCCGGCGTGTTCCGCTGCCGTCTGCCCGGCGCCTACTTCTTCTCCTTCA
CGCTGGGCAAGCTGCCGCGTAAGACGCTGTCGGTTAAGCTGATGAAGAACCGCGACGAGGTGCAGGCCAT
GATTTACGACGACGGCGCGTCGCGGCGCCGCGAGATGCAGAGCCAGAGCGTGATGCTGGCCCTGCGGCGC
GGCGACGCCGTCTGGCTGCTCAGCCACGACCACGACGGCTACGGCGCCTACAGCAACCACGGCAAGTACA
TCACCTTCTCCGGCTTCCTGGTGTACCCCGACCTCGCCCCCGCCGCCCCGCCGGGCCTCGGGGCCTCGGA
GCTACTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207458 protein sequence
Red=Cloning site Green=Tags(s)

MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDVATGQFRC
RVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAP
QYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFSAARTRSLVGSDAGPGPRHQPLAFDTEFVNI
GGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRR
GDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031909
ORF Size 987 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_031909.3
RefSeq Size 1436 bp
RefSeq ORF 990 bp
Locus ID 114900
UniProt ID Q9BXJ3
Cytogenetics 11p11.2
Domains C1Q
Protein Families Secreted Protein
MW 35.3 kDa
Gene Summary May be involved in the regulation of the inflammatory network. Its role as pro- or anti-inflammatory seems to be context dependent (PubMed:21658842, PubMed:27086950). Seems to have some role in regulating food intake and energy balance when administered in the brain. This effect is sustained over a two-day period, and it is accompanied by decreased expression of orexigenic neuropeptides in the hypothalamus 3 h post-injection (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "C1QTNF4"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Rabbit Polyclonal CTRP4 Antibody
    • 100 ug

USD 484.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.