MX1 (NM_002462) Human Tagged ORF Clone

CAT#: RC207418

Reviews ()
Write a review

MX1 (Myc-DDK-tagged)-Human myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse) (MX1), transcript variant 2



Reconstitution Protocol

USD 616.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MX1
Synonyms IFI-78K; IFI78; lncMX1-215; MX; MxA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207418 representing NM_002462
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTGTTTCCGAAGTGGACATCGCAAAAGCTGATCCAGCTGCTGCATCCCACCCTCTATTACTGAATG
GAGATGCTACTGTGGCCCAGAAAAATCCAGGCTCGGTGGCTGAGAACAACCTGTGCAGCCAGTATGAGGA
GAAGGTGCGCCCCTGCATCGACCTCATTGACTCCCTGCGGGCTCTAGGTGTGGAGCAGGACCTGGCCCTG
CCAGCCATCGCCGTCATCGGGGACCAGAGCTCGGGCAAGAGCTCCGTGTTGGAGGCACTGTCAGGAGTTG
CCCTTCCCAGAGGCAGCGGGATCGTGACCAGATGCCCGCTGGTGCTGAAACTGAAGAAACTTGTGAACGA
AGATAAGTGGAGAGGCAAGGTCAGTTACCAGGACTACGAGATTGAGATTTCGGATGCTTCAGAGGTAGAA
AAGGAAATTAATAAAGCCCAGAATGCCATCGCCGGGGAAGGAATGGGAATCAGTCATGAGCTAATCACCC
TGGAGATCAGCTCCCGAGATGTCCCGGATCTGACTCTAATAGACCTTCCTGGCATAACCAGAGTGGCTGT
GGGCAATCAGCCTGCTGACATTGGGTATAAGATCAAGACACTCATCAAGAAGTACATCCAGAGGCAGGAG
ACAATCAGCCTGGTGGTGGTCCCCAGTAATGTGGACATTGCCACCACAGAGGCTCTCAGCATGGCCCAGG
AGGTGGACCCCGAGGGAGACAGGACCATCGGAATCTTGACGAAGCCTGATCTGGTGGACAAAGGAACTGA
AGACAAGGTTGTGGACGTGGTGCGGAACCTCGTGTTCCACCTGAAGAAGGGTTACATGATTGTCAAGTGC
CGGGGCCAGCAGGAGATCCAGGACCAGCTGAGCCTGTCCGAAGCCCTGCAGAGAGAGAAGATCTTCTTTG
AGAACCACCCATATTTCAGGGATCTGCTGGAGGAAGGAAAGGCCACGGTTCCCTGCCTGGCAGAAAAACT
TACCAGCGAGCTCATCACACATATCTGTAAATCTCTGCCCCTGTTAGAAAATCAAATCAAGGAGACTCAC
CAGAGAATAACAGAGGAGCTACAAAAGTATGGTGTCGACATACCGGAAGACGAAAATGAAAAAATGTTCT
TCCTGATAGATAAAATTAATGCCTTTAATCAGGACATCACTGCTCTCATGCAAGGAGAGGAAACTGTAGG
GGAGGAAGACATTCGGCTGTTTACCAGACTCCGACACGAGTTCCACAAATGGAGTACAATAATTGAAAAC
AATTTTCAAGAAGGCCATAAAATTTTGAGTAGAAAAATCCAGAAATTTGAAAATCAGTATCGTGGTAGAG
AGCTGCCAGGCTTTGTGAATTACAGGACATTTGAGACAATCGTGAAACAGCAAATCAAGGCACTGGAAGA
GCCGGCTGTGGATATGCTACACACCGTGACGGATATGGTCCGGCTTGCTTTCACAGATGTTTCGATAAAA
AATTTTGAAGAGTTTTTTAACCTCCACAGAACCGCCAAGTCCAAAATTGAAGACATTAGAGCAGAACAAG
AGAGAGAAGGTGAGAAGCTGATCCGCCTCCACTTCCAGATGGAACAGATTGTCTACTGCCAGGACCAGGT
ATACAGGGGTGCATTGCAGAAGGTCAGAGAGAAGGAGCTGGAAGAAGAAAAGAAGAAGAAATCCTGGGAT
TTTGGGGCTTTCCAATCCAGCTCGGCAACAGACTCTTCCATGGAGGAGATCTTTCAGCACCTGATGGCCT
ATCACCAGGAGGCCAGCAAGCGCATCTCCAGCCACATCCCTTTGATCATCCAGTTCTTCATGCTCCAGAC
GTACGGCCAGCAGCTTCAGAAGGCCATGCTGCAGCTCCTGCAGGACAAGGACACCTACAGCTGGCTCCTG
AAGGAGCGGAGCGACACCAGCGACAAGCGGAAGTTCCTGAAGGAGCGGCTTGCACGGCTGACGCAGGCTC
GGCGCCGGCTTGCCCAGTTCCCCGGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207418 representing NM_002462
Red=Cloning site Green=Tags(s)

MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLAL
PAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVE
KEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQE
TISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKC
RGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETH
QRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIK
NFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWD
FGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLL
KERSDTSDKRKFLKERLARLTQARRRLAQFPG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002462
ORF Size 1986 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002462.5
RefSeq Size 2787 bp
RefSeq ORF 1989 bp
Locus ID 4599
UniProt ID P20591
Cytogenetics 21q22.3
Domains dynamin_2, dynamin, GED
Protein Families Druggable Genome
MW 75.3 kDa
Gene Summary This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA and DNA viruses. There is a related gene located adjacent to this gene on chromosome 21, and there are multiple pseudogenes located in a cluster on chromosome 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.