ETS2 (NM_005239) Human Tagged ORF Clone

CAT#: RC207377

ETS2 (Myc-DDK-tagged)-Human v-ets erythroblastosis virus E26 oncogene homolog 2 (avian) (ETS2)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ETS2 (NM_005239) Human Tagged ORF Clone
Symbol ETS2
Synonyms ETS2IT1; ETS2IT1
Vector pCMV6-Entry
Sequence Data
>RC207377 representing NM_005239
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGATTTCGGAATCAAGAATATGGACCAGGTAGCCCCTGTGGCTAACAGTTACAGAGGGACACTCA
AGCGCCAGCCAGCCTTTGACACCTTTGATGGGTCCCTGTTTGCTGTTTTTCCTTCTCTAAATGAAGAGCA
AACACTGCAAGAAGTGCCAACAGGCTTGGATTCCATTTCTCATGACTCCGCCAACTGTGAATTGCCTTTG
TTAACCCCGTGCAGCAAGGCTGTGATGAGTCAAGCCTTAAAAGCTACCTTCAGTGGCTTCAAAAAGGAAC
AGCGGCGCCTGGGCATTCCAAAGAACCCCTGGCTGTGGAGTGAGCAACAGGTATGCCAGTGGCTTCTCTG
GGCCACCAATGAGTTCAGTCTGGTGAACGTGAATCTGCAGAGGTTCGGCATGAATGGCCAGATGCTGTGT
AACCTTGGCAAGGAACGCTTTCTGGAGCTGGCACCTGACTTTGTGGGTGACATTCTCTGGGAACATCTGG
AGCAAATGATCAAAGAAAACCAAGAAAAGACAGAAGATCAATATGAAGAAAATTCACACCTCACCTCCGT
TCCTCATTGGATTAACAGCAATACATTAGGTTTTGGCACAGAGCAGGCGCCCTATGGAATGCAGACACAG
AATTACCCCAAAGGCGGCCTCCTGGACAGCATGTGTCCGGCCTCCACACCCAGCGTACTCAGCTCTGAGC
AGGAGTTTCAGATGTTCCCCAAGTCTCGGCTCAGCTCCGTCAGCGTCACCTACTGCTCTGTCAGTCAGGA
CTTCCCAGGCAGCAACTTGAATTTGCTCACCAACAATTCTGGGACGCCCAAAGACCACGACTCCCCTGAG
AACGGTGCGGACAGCTTCGAGAGCTCAGACTCCCTCCTCCAGTCCTGGAACAGCCAGTCGTCCTTGCTGG
ATGTGCAACGGGTTCCTTCCTTCGAGAGCTTCGAAGATGACTGCAGCCAGTCTCTCTGCCTCAATAAGCC
AACCATGTCTTTCAAGGATTACATCCAAGAGAGGAGTGACCCGGTGGAGCAAGGCAAACCAGTTATACCT
GCAGCTGTGCTGGCCGGCTTCACAGGAAGTGGACCTATTCAGCTGTGGCAGTTTCTCCTGGAGCTGCTAT
CAGACAAATCCTGCCAGTCATTCATCAGCTGGACTGGAGACGGATGGGAGTTTAAGCTCGCCGACCCCGA
TGAGGTGGCCCGCCGGTGGGGAAAGAGGAAAAATAAGCCCAAGATGAACTACGAGAAGCTGAGCCGGGGC
TTACGCTACTATTACGACAAGAACATCATCCACAAGACGTCGGGGAAGCGCTACGTGTACCGCTTCGTGT
GCGACCTCCAGAACTTGCTGGGGTTCACGCCCGAGGAACTGCACGCCATCCTGGGCGTCCAGCCAGACAC
GGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207377 representing NM_005239
Red=Cloning site Green=Tags(s)

MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPL
LTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLC
NLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQ
NYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPE
NGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIP
AAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005239
ORF Size 1407 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005239.1, NM_005239.2, NM_005239.3, NM_005239.4, NM_005239.5, NP_005230
RefSeq Size 3672
RefSeq ORF 1410
Locus ID 2114
Cytogenetics 21q22.2
Domains Ets, SAM_PNT
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Dorso-ventral axis formation
MW 52.8 kDa
Gene Summary This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)