MAFB (NM_005461) Human Tagged ORF Clone

CAT#: RC207311

Reviews ()
Write a review

MAFB (Myc-DDK-tagged)-Human v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian) (MAFB)



Reconstitution Protocol

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Other products for "MAFB"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MAFB
Synonyms DURS3; KRML; MCTO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207311 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGGAGCTGAGCATGGGGCCAGAGCTGCCCACCAGCCCGCTGGCCATGGAGTATGTCAACGACT
TCGACCTGCTCAAGTTCGACGTGAAGAAGGAGCCACTGGGGCGCGCGGAGCGTCCGGGCAGGCCCTGCAC
ACGCCTGCAGCCAGCCGGCTCGGTGTCCTCCACACCGCTCAGCACTCCGTGTAGCTCCGTGCCCTCGTCG
CCCAGCTTCAGCCCGACCGAACAGAAGACACACCTCGAGGATCTGTACTGGATGGCGAGCAACTACCAGC
AGATGAACCCCGAGGCGCTCAACCTGACGCCCGAGGACGCGGTGGAAGCGCTCATCGGCTCGCACCCAGT
GCCACAGCCGCTGCAAAGCTTCGACAGCTTTCGCGGCGCTCACCACCACCACCATCACCACCACCCTCAC
CCGCACCACGCGTACCCGGGCGCCGGCGTGGCCCACGACGAGCTGGGCCCGCACGCTCACCCGCACCATC
ACCATCATCACCAAGCGTCGCCGCCGCCGTCCAGCGCCGCTAGCCCGGCGCAACAGCTGCCCACTAGCCA
CCCCGGGCCCGGGCCGCACGCGACGGCCTCGGCGACGGCGGCGGGCGGCAACGGCAGCGTGGAGGACCGC
TTCTCCGATGACCAGCTCGTGTCCATGTCCGTGCGCGAGCTGAACCGCCACCTGCGGGGCTTCACCAAGG
ACGAGGTGATCCGCCTGAAGCAGAAGCGGCGGACCCTGAAGAACCGGGGCTACGCCCAGTCTTGCAGGTA
TAAACGCGTCCAGCAGAAGCACCACCTGGAGAATGAGAAGACGCAGCTCATTCAGCAGGTGGAGCAGCTT
AAGCAGGAGGTGTCCCGGCTGGCCCGCGAGAGAGACGCCTACAAGGTCAAGTGCGAGAAACTCGCCAACT
CCGGCTTCAGGGAGGCGGGCTCCACCAGCGACAGCCCCTCCTCTCCCGAGTTCTTTCTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC207311 protein sequence
Red=Cloning site Green=Tags(s)

MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSS
PSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
PHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATASATAAGGNGSVEDR
FSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQL
KQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005461
ORF Size 969 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005461.5
RefSeq Size 3395 bp
RefSeq ORF 972 bp
Locus ID 9935
UniProt ID Q9Y5Q3
Cytogenetics 20q12
Domains bZIP_Maf, BRLZ
Protein Families Druggable Genome, Transcription Factors
MW 35.8 kDa
Gene Summary The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.