HEF1 (NEDD9) (NM_006403) Human Tagged ORF Clone

CAT#: RC207200

Reviews ()
Write a review

NEDD9 (Myc-DDK-tagged)-Human neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 1



  "NM_006403" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 764.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "NEDD9"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NEDD9
Synonyms CAS-L; CAS2; CASL; CASS2; HEF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207200 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTATAAGAATCTTATGGCAAGGGCCTTATATGACAATGTCCCAGAGTGTGCCGAGGAACTGGCCT
TTCGCAAGGGAGACATCCTGACCGTCATAGAGCAGAACACAGGGGGACTGGAAGGATGGTGGCTGTGCTC
GTTACACGGTCGGCAAGGCATTGTCCCAGGCAACCGGGTGAAGCTTCTGATTGGTCCCATGCAGGAGACT
GCCTCCAGTCACGAGCAGCCTGCCTCTGGACTGATGCAGCAGACCTTTGGCCAACAGAAGCTCTATCAAG
TGCCAAACCCACAGGCTGCTCCCCGAGACACCATCTACCAAGTGCCACCTTCCTACCAAAATCAGGGAAT
TTACCAAGTCCCCACTGGCCACGGCACCCAAGAACAAGAGGTATATCAGGTGCCACCATCAGTGCAGAGA
AGCATTGGGGGAACCAGTGGGCCCCACGTGGGTAAAAAGGTGATAACCCCCGTGAGGACAGGCCATGGCT
ACGTATACGAGTACCCATCCAGATACCAAAAGGACGTCTATGATATCCCTCCTTCTCATACCACTCAAGG
GGTATACGACATCCCTCCCTCATCAGCAAAAGGCCCTGTGTTTTCAGTTCCAGTGGGAGAGATAAAACCT
CAAGGGGTGTATGACATCCCGCCTACAAAAGGGGTATATGCCATTCCGCCCTCTGCTTGCCGGGATGAAG
CAGGGCTTAGGGAAAAAGACTATGACTTCCCCCCTCCCATGAGACAAGCTGGAAGGCCGGACCTCAGACC
GGAGGGGGTTTATGACATTCCTCCAACCTGCACCAAGCCAGCAGGGAAGGACCTTCATGTAAAATACAAC
TGTGACATTCCAGGAGCTGCAGAACCGGTGGCTCGAAGGCACCAGAGCCTGTCCCCGAATCACCCACCCC
CGCAACTCGGACAGTCAGTGGGCTCTCAGAACGACGCATATGATGTCCCCCGAGGCGTTCAGTTTCTTGA
GCCACCAGCAGAAACCAGTGAGAAAGCAAACCCCCAGGAAAGGGATGGTGTTTATGATGTCCCTCTGCAT
AACCCGCCAGATGCTAAAGGCTCTCGGGACTTGGTGGATGGGATCAACCGATTGTCTTTCTCCAGTACAG
GCAGCACCCGGAGTAACATGTCCACGTCTTCCACCTCCTCCAAGGAGTCCTCACTGTCAGCCTCCCCAGC
TCAGGACAAAAGGCTCTTCCTGGATCCAGACACAGCTATTGAGAGACTTCAGCGGCTCCAGCAGGCCCTT
GAGATGGGTGTCTCCAGCCTAATGGCACTGGTCACTACCGACTGGCGGTGTTACGGATATATGGAAAGAC
ACATCAATGAAATACGCACAGCAGTGGACAAGGTGGAGCTGTTCCTGAAGGAGTACCTCCACTTTGTCAA
GGGAGCTGTTGCAAATGCTGCCTGCCTCCCGGAACTCATCCTCCACAACAAGATGAAGCGGGAGCTGCAA
CGAGTTGAAGACTCCCACCAGATCCTGAGTCAAACCAGCCATGACTTAAATGAGTGCAGCTGGTCCCTGA
ATATCTTGGCCATCAACAAGCCCCAGAACAAGTGTGACGATCTGGACCGGTTTGTGATGGTGGCAAAGAC
GGTGCCCGATGACGCCAAGCAGCTCACCACAACCATCAACACCAACGCAGAGGCCCTCTTCAGACCCGGC
CCTGGCAGCTTGCATCTGAAGAATGGGCCGGAGAGCATCATGAACTCAACGGAGTACCCACACGGTGGCT
CCCAGGGACAGCTGCTGCATCCTGGTGACCACAAGGCCCAGGCCCACAACAAGGCACTGCCCCCAGGCCT
GAGCAAGGAGCAGGCCCCTGACTGTAGCAGCAGTGATGGTTCTGAGAGGAGCTGGATGGATGACTACGAT
TACGTCCACCTACAGGGTAAGGAGGAGTTTGAGAGGCAACAGAAAGAGCTATTGGAAAAAGAGAATATCA
TGAAACAGAACAAGATGCAGCTGGAACATCATCAGCTGAGCCAGTTCCAGCTGTTGGAACAAGAGATTAC
AAAGCCCGTGGAGAATGACATCTCGAAGTGGAAGCCCTCTCAGAGCCTACCCACCACAAACAGTGGCGTG
AGTGCTCAGGATCGGCAGTTGCTGTGCTTCTACTATGACCAATGTGAGACCCATTTCATTTCCCTTCTCA
ACGCCATTGACGCACTCTTCAGTTGTGTCAGCTCAGCCCAGCCCCCGCGAATCTTCGTGGCACACAGCAA
GTTTGTCATCCTCAGTGCACACAAACTGGTGTTCATTGGAGACACGCTGACACGGCAGGTGACTGCCCAG
GACATTCGCAACAAAGTCATGAACTCCAGCAACCAGCTCTGCGAGCAGCTCAAGACCATAGTCATGGCAA
CCAAGATGGCCGCCCTCCATTACCCCAGCACCACGGCCCTGCAGGAAATGGTGCACCAAGTGACAGACCT
TTCTAGAAATGCCCAGCTGTTCAAGCGCTCTTTGCTGGAGATGGCAACGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207200 protein sequence
Red=Cloning site Green=Tags(s)

MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQET
ASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQR
SIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKP
QGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYN
CDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
NPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQ
RVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPG
PGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGLSKEQAPDCSSSDGSERSWMDDYD
YVHLQGKEEFERQQKELLEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGV
SAQDRQLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQ
DIRNKVMNSSNQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006403
ORF Size 2502 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006403.2, NP_006394.1
RefSeq Size 4550 bp
RefSeq ORF 2505 bp
Locus ID 4739
UniProt ID Q14511
Cytogenetics 6p24.2
Domains SH3
MW 92.9 kDa
Gene Summary The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.