YTHDF1 (NM_017798) Human Tagged ORF Clone

CAT#: RC207185

Reviews ()
Write a review

YTHDF1 (Myc-DDK-tagged)-Human YTH domain family, member 1 (YTHDF1)



Reconstitution Protocol

USD 520.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "YTHDF1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol YTHDF1
Synonyms C20orf21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207185 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCCACCAGCGTGGACACCCAGAGAACAAAAGGACAAGATAATAAAGTACAAAATGGTTCGTTAC
ATCAGAAGGATACAGTTCATGACAATGACTTTGAGCCCTACCTTACTGGACAGTCAAATCAGAGTAACAG
TTACCCCTCAATGAGCGACCCCTACCTGTCCAGCTATTACCCGCCGTCCATTGGATTTCCTTACTCCCTC
AATGAGGCTCCGTGGTCTACTGCAGGGGACCCTCCGATTCCATACCTCACCACCTACGGACAGCTCAGTA
ACGGAGACCATCATTTTATGCACGATGCTGTTTTTGGGCAGCCTGGGGGCCTGGGGAACAACATCTATCA
GCACAGGTTCAATTTTTTCCCTGAAAACCCTGCGTTCTCAGCATGGGGGACAAGTGGGTCTCAAGGTCAG
CAGACCCAGAGCTCCGCGTATGGGAGCAGCTACACCTACCCCCCGAGCTCCCTGGGTGGCACGGTGGTTG
ATGGGCAGCCAGGCTTTCACAGCGACACCCTCAGCAAGGCCCCCGGGATGAACAGCCTGGAGCAGGGCAT
GGTTGGCCTGAAGATTGGGGACGTCAGCTCCTCCGCCGTCAAGACGGTGGGCTCTGTCGTCAGCAGCGTG
GCACTGACTGGTGTCCTTTCTGGCAACGGTGGGACAAATGTGAACATGCCAGTTTCAAAGCCGACCTCGT
GGGCTGCCATTGCCAGCAAGCCTGCAAAACCACAGCCTAAAATGAAAACAAAGAGCGGGCCTGTCATGGG
GGGTGGGCTGCCCCCTCCACCCATAAAGCATAACATGGACATTGGCACCTGGGATAACAAGGGGCCTGTG
CCGAAGGCCCCAGTCCCCCAGCAGGCACCCTCTCCACAGGCTGCCCCACAGCCCCAGCAGGTGGCTCAGC
CTCTCCCAGCACAGCCCCCAGCTTTGGCTCAACCGCAGTATCAGAGCCCTCAGCAGCCACCCCAGACCCG
CTGGGTTGCCCCACGCAACAGAAACGCGGCGTTTGGGCAGAGCGGAGGGGCTGGCAGCGATAGCAACTCT
CCTGGAAACGTCCAGCCTAATTCTGCCCCCAGCGTCGAATCCCACCCCGTCCTTGAAAAACTGAAGGCTG
CTCACAGCTACAACCCGAAAGAGTTTGAGTGGAATCTGAAAAGCGGGCGTGTGTTCATCATCAAGAGCTA
CTCTGAGGACGACATCCACCGCTCCATTAAGTACTCCATCTGGTGTAGCACAGAGCACGGCAACAAGCGC
CTGGACAGCGCCTTCCGCTGCATGAGCAGCAAGGGGCCCGTCTACCTGCTCTTCAGCGTCAATGGGAGTG
GGCATTTTTGTGGGGTGGCCGAGATGAAGTCCCCCGTGGACTACGGCACCAGTGCCGGGGTCTGGTCTCA
GGACAAGTGGAAGGGGAAGTTTGATGTCCAGTGGATTTTTGTTAAGGATGTACCCAATAACCAGCTCCGG
CACATCAGGCTGGAGAATAACGACAACAAACCGGTCACAAACTCCCGGGACACCCAGGAGGTGCCCTTAG
AAAAAGCCAAGCAAGTGCTGAAAATTATCAGTTCCTACAAGCACACAACCTCCATCTTCGACGACTTTGC
TCACTACGAGAAGCGCCAGGAGGAGGAGGAGGTGGTGCGCAAGGAACGGCAGAGTCGAAACAAACAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207185 protein sequence
Red=Cloning site Green=Tags(s)

MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSL
NEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQ
QTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSV
ALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPV
PKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNS
PGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR
LDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLR
HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017798
ORF Size 1677 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017798.4
RefSeq Size 3277 bp
RefSeq ORF 1680 bp
Locus ID 54915
UniProt ID Q9BYJ9
Cytogenetics 20q13.33
MW 60.9 kDa
Gene Summary Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency (PubMed:24284625, PubMed:26046440, PubMed:26318451). M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability (PubMed:24284625). Acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation (PubMed:26046440). Required to facilitate learning and memory formation in the hippocampus by enhancing protein synthesis upon neuronal stimulation: in response to neuronal stimulation, binds to m6A-containing neuronal mRNAs, promoting their translation, thereby contributing to learning and memory (By similarity). Acts as a regulator of axon guidance by binding to m6A-containing ROBO3 transcripts, thereby promoting their translation (By similarity). Acts as a negative regulator of antigen cross-presentation in myeloid dendritic cells (By similarity). Acts by binding and promoting translation of m6A-containing transcripts encoding proteins involved in lysosomal degradation and phagosome maturation, leading to increased antigen degradation in myeloid dendritic cells (By similarity). In the context of tumorigenesis, negative regulation of antigen cross-presentation limits the anti-tumor response by reducing efficiency of tumor-antigen cross-presentation (By similarity).[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.