TFEB (NM_007162) Human Tagged ORF Clone

CAT#: RC207153

Reviews ()
Write a review

TFEB (Myc-DDK-tagged)-Human transcription factor EB (TFEB), transcript variant 1



  "NM_007162" in other vectors (6)

Reconstitution Protocol

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "TFEB"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TFEB
Synonyms ALPHATFEB; BHLHE35; TCFEB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207153 representing NM_007162
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCACGCATAGGGTTGCGCATGCAGCTCATGCGGGAGCAGGCGCAGCAGGAGGAGCAGCGGGAGC
GCATGCAGCAACAGGCTGTCATGCATTACATGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCTCGGAGG
GCCGCCCACCCCGGCCATCAATACCCCCGTCCACTTCCAGTCGCCACCACCTGTGCCTGGGGAGGTGTTG
AAGGTGCAGTCCTACCTGGAGAATCCCACATCCTACCATCTGCAGCAGTCGCAGCATCAGAAGGTGCGGG
AGTACCTGTCCGAGACCTATGGGAACAAGTTTGCTGCCCACATCAGCCCAGCCCAGGGCTCTCCGAAACC
CCCACCAGCCGCCTCCCCAGGGGTGCGAGCTGGACACGTGCTGTCCTCCTCCGCTGGCAACAGTGCTCCC
AATAGCCCCATGGCCATGCTGCACATTGGCTCCAACCCTGAGAGGGAGTTGGATGATGTCATTGACAACA
TTATGCGTCTGGACGATGTCCTTGGCTACATCAATCCTGAAATGCAGATGCCCAACACGCTACCCCTGTC
CAGCAGCCACCTGAATGTGTACAGCAGCGACCCCCAGGTCACAGCCTCCCTGGTGGGCGTCACCAGCAGC
TCCTGCCCTGCGGACCTGACCCAGAAGCGAGAGCTCACAGATGCTGAGAGCAGGGCCCTGGCCAAGGAGC
GGCAGAAGAAAGACAATCACAACTTAATTGAAAGGAGACGAAGGTTCAACATCAATGACCGCATCAAGGA
GTTGGGAATGCTGATCCCCAAGGCCAATGACCTGGACGTGCGCTGGAACAAGGGCACCATCCTCAAGGCC
TCTGTGGATTACATCCGGAGGATGCAGAAGGACCTGCAAAAGTCCAGGGAGCTGGAGAACCACTCTCGCC
GCCTGGAGATGACCAACAAGCAGCTCTGGCTCCGTATCCAGGAGCTGGAGATGCAGGCTCGAGTGCACGG
CCTCCCTACCACCTCCCCGTCCGGCATGAACATGGCTGAGCTGGCCCAGCAGGTGGTGAAGCAGGAGCTG
CCTAGCGAAGAGGGCCCAGGGGAGGCCCTGATGCTGGGGGCTGAGGTCCCTGACCCTGAGCCACTGCCAG
CTCTGCCCCCGCAAGCCCCGCTGCCCCTGCCCACCCAGCCACCATCCCCATTCCATCACCTGGACTTCAG
CCACAGCCTGAGCTTTGGGGGCAGGGAGGACGAGGGTCCCCCGGGCTACCCCGAACCCCTGGCGCCGGGG
CATGGCTCCCCATTCCCCAGCCTGTCCAAGAAGGATCTGGACCTCATGCTCCTGGACGACTCACTGCTAC
CGCTGGCCTCTGATCCACTTCTGTCCACCATGTCCCCCGAGGCCTCCAAGGCCAGCAGCCGCCGGAGCAG
CTTCAGCATGGAGGAGGGCGATGTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207153 representing NM_007162
Red=Cloning site Green=Tags(s)

MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVL
KVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAP
NSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSS
SCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKA
SVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQEL
PSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG
HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007162
ORF Size 1428 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007162.2
RefSeq Size 2364 bp
RefSeq ORF 1431 bp
Locus ID 7942
UniProt ID P19484
Cytogenetics 6p21.1
Protein Families Druggable Genome, Transcription Factors
MW 52.9 kDa
Gene Summary Transcription factor that specifically recognizes and binds E-box sequences (5'-CANNTG-3'). Efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFE3 or MITF. In association with TFE3, activates the expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells and thymus-dependent humoral immunity. Specifically recognizes and binds the CLEAR-box sequence (5'-GTCACGTGAC-3') present in the regulatory region of many lysosomal genes, leading to activate their expression. It thereby plays a central role in expression of lysosomal genes. Acts as a positive regulator of autophagy by promoting expression of genes involved in autophagy. Specifically recognizes the gamma-E3 box, a subset of E-boxes, present in the heavy-chain immunoglobulin enhancer. Plays a role in the signal transduction processes required for normal vascularization of the placenta. Regulates lysosomal positioning in response to nutrient deprivation by promoting the expression of PIP4P1 (PubMed:29146937).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.