OriGene Logo

FAM133B (NM_152789) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207142
FAM133B (Myc-DDK-tagged)-Human family with sequence similarity 133, member B (FAM133B), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Size
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA357172 FAM133B Antibody - C-terminal region 100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags 30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA) 5 x 200 ul
$160.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each 100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug 10 ug
$650.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL 5 ml
$720.00

Other products for "FAM133B or NM_152789"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FAM133B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207142 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCCAATAGCAATGGCGAGATCAAGGGGTCCAATCCAGTCTTCAGGGCCAACAATACAGGATTATC
TGAATCGACCAAGGCCTACCTGGGAAGAAGTAAAAGAGCAACTAGAAAAGAAAAAGAAAGGCTCCAAGGC
TTTGGCTGAATTTGAAGAAAAAATGAATGAGAACTGGAAGAAAGAACTGGAAAAACACAGGGAGAAATTG
TTAAGTGGAAGTGAGAGCTCATCCAAAAAAAGACAGAGAAAGAAAAAAGAAAAGAAGAAATCTGGTAGGT
ATTCATCTTCTTCTTCATCAAGCTCTGATTCTTCCAGCAGTTCTTCTGATTCTGAAGATGAGGATAAGAA
ACAAGGAAAACGGAGAAAGAAAAAGAAGAACCGTTCACATAAATCTTCTGAAAGCTCCATGTCAGAAACT
GAATCAGACAGTAAGGATAGTTTAAAAAAGAAAAAGAAGTCAAAAGATGGAACTGAGAAAGAAAAGGATA
TTAAAGGACTCAGCAAAAAGAGAAAGATGTATTCTGAAGATAAACCTTTATCATCTGAGTCCTTGTCAGA
ATCAGAGTATATTGAGGAGGTGCGAGCAAAAAAGAAGAAAAGCAGTGAAGAACGAGAAAAAGCAACAGAA
AAAACAAAAAAGAAAAAGAAGCATAAGAAACACAGTAAGAAGAAGAAAAAGAAGGCTGCTAGTTCAAGTC
CTGACTCACCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207142 protein sequence
Red=Cloning site Green=Tags(s)

MNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKL
LSGSESSSKKRQRKKKEKKKSGRYSSSSSSSSDSSSSSSDSEDEDKKQGKRRKKKKNRSHKSSESSMSET
ESDSKDSLKKKKKSKDGTEKEKDIKGLSKKRKMYSEDKPLSSESLSESEYIEEVRAKKKKSSEEREKATE
KTKKKKKHKKHSKKKKKKAASSSPDSP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_152789
ORF Size 711 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152789.1, NP_690002.1
RefSeq Size 2371 bp
RefSeq ORF 744 bp
Locus ID 257415
UniProt ID Q5BKY9
Cytogenetics 7q21.2
MW 27.2 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_152789" in other vectors (5)
SKU Description Size Price
RC207142L3 Lenti ORF clone of Human family with sequence similarity 133, member B (FAM133B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207142L4 Lenti ORF clone of Human family with sequence similarity 133, member B (FAM133B), transcript variant 1, mGFP tagged 10 ug
$600.00
RG207142 FAM133B (tGFP-tagged) - Human family with sequence similarity 133, member B (FAM133B), transcript variant 1 10 ug
$489.00 $500.00
SC100788 FAM133B (untagged)-Human family with sequence similarity 133, member B (FAM133B), transcript variant 1 10 ug
$300.00
SC322154 FAM133B (untagged)-Human family with sequence similarity 133, member B (FAM133B), transcript variant 1 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.