Claudin 5(CLDN5) (NM_003277) Human Tagged ORF Clone

CAT#: RC207122

CLDN5 (Myc-DDK-tagged)-Human claudin 5 (CLDN5), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Claudin 5(CLDN5) (NM_003277) Human Tagged ORF Clone
Symbol CLDN5
Synonyms AWAL; BEC1; CPETRL1; TMVCF
Vector pCMV6-Entry
Sequence Data
>RC207122 representing NM_003277
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTCCGCAGCGTTGGAGATCCTGGGCCTGGTGCTGTGCCTGGTGGGCTGGGGGGGTCTGATCCTGG
CGTGCGGGCTGCCCATGTGGCAGGTGACCGCCTTCCTGGACCACAACATCGTGACGGCGCAGACCACCTG
GAAGGGGCTGTGGATGTCGTGCGTGGTGCAGAGCACCGGGCACATGCAGTGCAAAGTGTACGACTCGGTG
CTGGCTCTGAGCACCGAGGTGCAGGCGGCGCGGGCGCTCACCGTGAGCGCCGTGCTGCTGGCGTTCGTTG
CGCTCTTCGTGACCCTGGCGGGCGCGCAGTGCACCACCTGCGTGGCCCCGGGCCCGGCCAAGGCGCGTGT
GGCCCTCACGGGAGGCGTGCTCTACCTGTTTTGCGGGCTGCTGGCGCTCGTGCCACTCTGCTGGTTCGCC
AACATTGTCGTCCGCGAGTTTTACGACCCGTCTGTGCCCGTGTCGCAGAAGTACGAGCTGGGCGCAGCGC
TGTACATCGGCTGGGCGGCCACCGCGCTGCTCATGGTAGGCGGCTGCCTCTTGTGCTGCGGCGCCTGGGT
CTGCACCGGCCGTCCCGACCTCAGCTTCCCCGTGAAGTACTCAGCGCCGCGGCGGCCCACGGCCACCGGC
GACTACGACAAGAAGAACTACGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207122 representing NM_003277
Red=Cloning site Green=Tags(s)

MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSV
LALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFA
NIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATG
DYDKKNYV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003277
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003277.1, NM_003277.2, NP_003268
RefSeq Size 1730
RefSeq ORF 912
Locus ID 7122
Cytogenetics 22q11.21
Domains PMP22_Claudin
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Tight junction, Leukocyte transendothelial migration
MW 23 kDa
Gene Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)