CSRP1 (NM_004078) Human Tagged ORF Clone

CAT#: RC207109

CSRP1 (Myc-DDK-tagged)-Human cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CSRP1 (NM_004078) Human Tagged ORF Clone
Symbol CSRP1
Synonyms CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141
Vector pCMV6-Entry
Sequence Data
>RC207109 representing NM_004078
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAACTGGGGAGGAGGCAAGAAATGTGGGGTGTGTCAGAAGACGGTTTACTTTGCCGAAGAGGTTC
AGTGCGAAGGCAACAGCTTCCATAAATCCTGCTTCCTGTGCATGGTCTGCAAGAAGAATCTGGACAGTAC
CACTGTGGCCGTGCATGGTGAGGAGATTTACTGCAAGTCCTGCTACGGCAAGAAGTATGGGCCCAAAGGC
TATGGCTACGGGCAGGGCGCAGGCACCCTCAGCACTGACAAGGGGGAGTCGCTGGGTATCAAGCACGAGG
AAGCCCCTGGCCACAGGCCCACCACCAACCCCAATGCATCCAAATTTGCCCAGAAGATTGGTGGCTCCGA
GCGCTGCCCCCGATGCAGCCAGGCAGTCTATGCTGCGGAGAAGGTGATTGGTGCTGGGAAGTCCTGGCAT
AAGGCCTGCTTTCGATGTGCCAAGTGTGGCAAAGGCCTTGAGTCAACCACCCTGGCAGACAAGGATGGCG
AGATTTACTGCAAAGGATGTTATGCTAAAAACTTCGGGCCCAAGGGCTTTGGTTTTGGGCAAGGAGCTGG
GGCCTTGGTCCACTCTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207109 representing NM_004078
Red=Cloning site Green=Tags(s)

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG
YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH
KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004078
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004078.1, NM_004078.2, NP_004069
RefSeq Size 1817
RefSeq ORF 582
Locus ID 1465
Cytogenetics 1q32.1
Domains LIM
MW 20.4 kDa
Gene Summary Could play a role in neuronal development. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)