NALP12 (NLRP12) (NM_144687) Human Tagged ORF Clone

CAT#: RC207045

Reviews ()
Write a review

NLRP12 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 12 (NLRP12), transcript variant 2



  "NM_144687" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,258.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NLRP12
Synonyms CLR19.3; FCAS2; NALP12; PAN6; PYPAF7; RNO; RNO2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207045 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTACGAACCGCAGGCAGGGACGGCCTCTGTCGCCTGTCCACCTACTTGGAAGAACTCGAGGCTGTGG
AACTGAAGAAGTTCAAGTTATACCTGGGGACCGCGACAGAGCTGGGAGAAGGCAAGATCCCCTGGGGAAG
CATGGAGAAGGCCGGTCCCCTGGAAATGGCCCAGCTGCTCATCACCCACTTCGGGCCAGAGGAGGCCTGG
AGGTTGGCTCTCAGCACCTTTGAGCGGATAAACAGGAAGGACCTGTGGGAGAGAGGACAGAGAGAGGACC
TGGTGAGGGATACCCCACCTGGTGGCCCGTCCTCACTTGGGAACCAGTCAACATGCCTTCTGGAAGTCTC
TCTTGTCACTCCAAGAAAAGATCCCCAGGAAACCTACAGGGACTATGTCCGCAGGAAATTCCGGCTCATG
GAAGACCGCAATGCGCGCCTAGGGGAATGTGTCAACCTCAGCCACCGGTACACCCGGCTCCTGCTGGTGA
AGGAGCACTCAAACCCCATGCAGGTCCAGCAGCAGCTTCTGGACACAGGCCGGGGACACGCGAGGACCGT
GGGACACCAGGCTAGCCCCATCAAGATAGAGACCCTCTTTGAGCCAGACGAGGAGCGCCCCGAGCCACCG
CGCACCGTGGTCATGCAAGGCGCGGCAGGGATAGGCAAGTCCATGCTGGCACACAAGGTGATGCTGGACT
GGGCGGACGGGAAGCTCTTCCAAGGCAGATTTGATTATCTCTTCTACATCAACTGCAGGGAGATGAACCA
GAGTGCCACGGAATGCAGCATGCAAGACCTCATCTTCAGCTGCTGGCCTGAGCCCAGCGCGCCTCTCCAG
GAGCTCATCCGAGTTCCCGAGCGCCTCCTTTTCATCATCGACGGCTTCGATGAGCTCAAGCCTTCTTTCC
ACGATCCTCAGGGACCCTGGTGCCTCTGCTGGGAGGAGAAACGGCCCACGGAGCTGCTTCTTAACAGCTT
AATTCGGAAGAAGCTGCTCCCTGAGCTATCTTTGCTCATCACCACACGGCCCACGGCTTTGGAGAAGCTC
CACCGTCTGCTGGAGCACCCCAGGCATGTGGAGATCCTGGGCTTCTCTGAGGCAGAAAGGAAGGAATACT
TCTACAAGTATTTCCACAATGCAGAGCAGGCGGGCCAAGTCTTCAATTACGTGAGGGACAACGAGCCTCT
CTTCACCATGTGCTTCGTCCCCCTGGTGTGCTGGGTGGTGTGTACCTGCCTCCAGCAGCAGCTGGAGGGT
GGGGGGCTGTTGAGACAGACGTCCAGGACCACCACTGCAGTGTACATGCTCTACCTGCTGAGTCTGATGC
AACCCAAGCCGGGGGCCCCGCGCCTCCAGCCCCCACCCAACCAGAGAGGGTTGTGCTCCTTGGCGGCAGA
TGGGCTCTGGAATCAGAAAATCCTATTTGAGGAGCAGGACCTCCGGAAGCACGGCCTAGACGGGGAAGAC
GTCTCTGCCTTCCTCAACATGAACATCTTCCAGAAGGACATCAACTGTGAGAGGTACTACAGCTTCATCC
ACTTGAGTTTCCAGGAATTCTTTGCAGCTATGTACTATATCCTGGACGAGGGGGAGGGCGGGGCAGGCCC
AGACCAGGACGTGACCAGGCTGTTGACCGAGTACGCGTTTTCTGAAAGGAGCTTCCTGGCACTCACCAGC
CGCTTCCTGTTTGGACTCCTGAACGAGGAGACCAGGAGCCACCTGGAGAAGAGTCTCTGCTGGAAGGTCT
CGCCGCACATCAAGATGGACCTGTTGCAGTGGATCCAAAGCAAAGCTCAGAGCGACGGCTCCACCCTGCA
GCAGGGCTCCTTGGAGTTCTTCAGCTGCTTGTACGAGATCCAGGAGGAGGAGTTTATCCAGCAGGCCCTG
AGCCACTTCCAGGTGATCGTGGTCAGCAACATTGCCTCCAAGATGGAGCACATGGTCTCCTCGTTCTGTC
TGAAGCGCTGCAGGAGCGCCCAGGTGCTGCACTTGTATGGCGCCACCTACAGCGCGGACGGGGAAGACCG
CGCGAGGTGCTCCGCAGGAGCGCACACGCTGTTGGTGCAGCTACCAGAGAGGACCGTTCTGCTGGACGCC
TACAGTGAACATCTGGCAGCGGCCCTGTGCACCAATCCAAACCTGATAGAGCTGTCTCTGTACCGAAATG
CCCTGGGCAGCCGGGGGGTGAAGCTGCTCTGTCAAGGACTCAGACACCCCAACTGCAAACTTCAGAACCT
GAGGCTGAAGAGGTGCCGCATCTCCAGCTCAGCCTGCGAGGACCTCTCTGCAGCTCTCATAGCCAATAAG
AATTTGACAAGGATGGATCTCAGTGGCAACGGCGTTGGATTCCCAGGCATGATGCTGCTTTGCGAGGGCC
TGCGGCATCCCCAGTGCAGGCTGCAGATGATTCAGTTGAGGAAGTGTCAGCTGGAGTCCGGGGCTTGTCA
GGAGATGGCTTCTGTGCTCGGCACCAACCCACATCTGGTTGAGTTGGACCTGACAGGAAATGCACTGGAG
GATTTGGGCCTGAGGTTACTATGCCAGGGACTGAGGCACCCAGTCTGCAGACTACGGACTTTGTGGCTGA
AGATCTGCCGCCTCACTGCTGCTGCCTGTGACGAGCTGGCCTCAACTCTCAGTGTGAACCAGAGCCTGAG
AGAGCTGGACCTGAGCCTGAATGAGCTGGGGGACCTCGGGGTGCTGCTGCTGTGTGAGGGCCTCAGGCAT
CCCACGTGCAAGCTCCAGACCCTGCGGTTGGGCATCTGCCGGCTGGGCTCTGCCGCCTGTGAGGGTCTTT
CTGTGGTGCTCCAGGCCAACCACAACCTCCGGGAGCTGGACTTGAGTTTCAACGACCTGGGAGACTGGGG
CCTGTGGTTGCTGGCTGAGGGGCTGCAACATCCCGCCTGCAGACTCCAGAAACTGTGGCTGGATAGCTGT
GGCCTCACAGCCAAGGCTTGTGAGAATCTTTACTTCACCCTGGGGATCAACCAGACCTTGACCGACCTTT
ACCTGACCAACAACGCCCTAGGGGACACAGGTGTCCGACTGCTTTGCAAGCGGCTGAGCCATCCTGGCTG
CAAACTCCGAGTCCTCTGGTTATTTGGGATGGACCTGAATAAAATGACCCACAGTAGGTTGGCAGCGCTT
CGAGTAACAAAACCTTATTTGGACATTGGCTGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC207045 protein sequence
Red=Cloning site Green=Tags(s)

MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLEMAQLLITHFGPEEAW
RLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQSTCLLEVSLVTPRKDPQETYRDYVRRKFRLM
EDRNARLGECVNLSHRYTRLLLVKEHSNPMQVQQQLLDTGRGHARTVGHQASPIKIETLFEPDEERPEPP
RTVVMQGAAGIGKSMLAHKVMLDWADGKLFQGRFDYLFYINCREMNQSATECSMQDLIFSCWPEPSAPLQ
ELIRVPERLLFIIDGFDELKPSFHDPQGPWCLCWEEKRPTELLLNSLIRKKLLPELSLLITTRPTALEKL
HRLLEHPRHVEILGFSEAERKEYFYKYFHNAEQAGQVFNYVRDNEPLFTMCFVPLVCWVVCTCLQQQLEG
GGLLRQTSRTTTAVYMLYLLSLMQPKPGAPRLQPPPNQRGLCSLAADGLWNQKILFEEQDLRKHGLDGED
VSAFLNMNIFQKDINCERYYSFIHLSFQEFFAAMYYILDEGEGGAGPDQDVTRLLTEYAFSERSFLALTS
RFLFGLLNEETRSHLEKSLCWKVSPHIKMDLLQWIQSKAQSDGSTLQQGSLEFFSCLYEIQEEEFIQQAL
SHFQVIVVSNIASKMEHMVSSFCLKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDA
YSEHLAAALCTNPNLIELSLYRNALGSRGVKLLCQGLRHPNCKLQNLRLKRCRISSSACEDLSAALIANK
NLTRMDLSGNGVGFPGMMLLCEGLRHPQCRLQMIQLRKCQLESGACQEMASVLGTNPHLVELDLTGNALE
DLGLRLLCQGLRHPVCRLRTLWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRH
PTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSC
GLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAAL
RVTKPYLDIGC

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_144687
ORF Size 3183 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_144687.4
RefSeq Size 3880 bp
RefSeq ORF 3186 bp
Locus ID 91662
UniProt ID P59046
Cytogenetics 19q13.42
Domains LRR, PAAD_DAPIN
MW 120.2 kDa
Gene Summary This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Mutations in this gene cause familial cold autoinflammatory syndrome type 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]

Other Versions

Other products for "NLRP12"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal NALP12 Antibody
    • 100 ug

USD 484.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.